KEGG   Acidovorax ebreus: Dtpsy_1250
Entry
Dtpsy_1250        CDS       T00853                                 

Definition
(GenBank) GTP-binding protein TypA
  KO
K06207  GTP-binding protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Dtpsy_1250
SSDB
Motif
Pfam: GTP_EFTU EFG_C GTP_EFTU_D2 MMR_HSR1 EFG_III Septin AIG1 SRPRB
Other DBs
NCBI-ProteinID: ACM32717
UniProt: B9MGP4
Position
1313860..1315689
AA seq 609 aa
MSKQIRNIAIIAHVDHGKTTMVDQLLRQSGTFAEHEKVVDTVMDSNAIERERGITILAKN
CAVSWNGTHINILDTPGHADFGGEVERALSMVDGVVLLIDAQEGPMPQTRFVTKKALALG
LKPIVVVNKVDKPGARPDYVVNAAFDLFDKLGATDEQLDFPVVYASGINGWSALEQGNPG
EQWGPDMSALFETILKHVPSVKGDATAPLQMQVSALDYSTFVGRIGVGRITQGTLKAGQD
VLVMAGPDGASYKGRVNQIHQFQGLDRVQVTEAGPSEIVLINGIENVGIGETLTDPANPQ
PLPMLKIDEPTLTMNFCVNTSPLAGREGKFVTSRQIWDRLQKELRSNVALRVKETDEDGI
FEVSGRGELHLTILLEEMRREGYELAVSKPRVVYRDIDGERCEPIELVTADIEEGHQGGV
MQALGERKGELVNMEPDGRGRVRLEYRIPARGLIGFTNEFLNLTRGSGLISNIFDSYEPH
KGDIGGRKNGVLISMDDGEIFTYALGKLDDRGRMFVKAGDPVYEGMIVGVHNRDNDLVVN
ATRTKQLTNFRVSGKEDAIKITPPIDLTLEYGVEFIEDDELVEITPKSIRLRKRHLKEHE
RKRASREGA
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgagcaaacaaatccgcaacatcgccatcatcgctcacgtcgaccatggcaagaccacg
atggtggaccaactgctgcgccagtccggcaccttcgccgagcacgagaaggtcgtggac
accgtgatggacagcaacgccatcgagcgcgagcgcggcatcaccatcctggcgaagaac
tgcgccgtgagctggaacggcacgcacatcaacatcctggacacgcccggccacgcggac
ttcggcggcgaggtggagcgtgccctgtcgatggtggacggcgtggtgctgctgatcgac
gcgcaggaaggccccatgccccagacgcgcttcgtgaccaagaaggcgctggcgctgggc
ctcaagcccatcgtggtggtcaacaaggtggacaagcccggcgcgcgccccgactacgtg
gtgaacgccgctttcgacctgttcgacaagctgggagccaccgacgagcaactggacttc
cccgtggtctacgcctcgggcatcaacggctggagcgcgctggaacagggcaaccccggt
gagcagtggggccccgacatgtcggcgctgttcgagaccatcctcaagcacgtgccgtcc
gtgaagggcgacgccacggcgccgctgcagatgcaggtttcggcgctggactattccacg
ttcgtcggccgtatcggtgtgggccgtatcacccagggtacgctcaaggccgggcaggat
gtgctggtcatggccgggccggatggcgccagctacaagggccgcgtgaaccagatccac
cagttccagggccttgaccgcgtgcaggtgaccgaagccggccccagcgagatcgtgctc
atcaacggcatcgagaacgtgggtatcggcgagaccctcaccgaccccgccaacccccag
ccgctgcccatgctgaagatcgacgagcccacgctgacgatgaacttctgcgtgaacacc
tcgccgctggcgggccgtgaaggcaaattcgtgaccagccgccagatctgggaccgcctg
cagaaggagctgcgttccaacgtggccctgcgcgtcaaggaaaccgacgaggacggcatc
ttcgaggtgtccggccgcggcgaactgcacctgaccatcctgctggaagaaatgcgccgt
gaaggctacgagttggccgtctccaagccgcgcgtggtgtaccgcgacatcgacggcgag
cgctgcgagcctatcgaactggtgactgctgatatcgaggaaggccaccaaggcggtgtg
atgcaggccctcggcgagcgcaagggtgaactggtgaacatggagcccgacggccgtggc
cgcgtgcgcctggagtaccgcatcccggcccgtggcctgatcggtttcaccaacgaattt
ctgaacctgacgcgcggctcgggcctcatcagcaacatcttcgacagctatgagccgcat
aagggcgacattggcggccgcaagaacggcgtgctgatttccatggacgatggtgaaatt
tttacctacgccctgggcaagctcgacgaccgtggccgcatgttcgtgaaggcaggcgac
ccggtgtacgaaggcatgatcgtcggcgtgcacaaccgcgacaacgacctggtggtgaac
gccacgcgtaccaagcagctcaccaacttccgcgtgagcggcaaggaagacgcgatcaag
atcacgcccccgatcgacctcacgctggagtacggtgtggagttcatcgaggacgatgaa
ctggtggagatcacgcccaagagcattcgcctgcgcaagcgccacctcaaggagcacgag
cgcaagcgcgccagccgcgaaggcgcgtga

DBGET integrated database retrieval system