KEGG   Acidovorax ebreus: Dtpsy_1251
Entry
Dtpsy_1251        CDS       T00853                                 

Definition
(GenBank) protein of unknown function DUF6 transmembrane
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-ProteinID: ACM32718
UniProt: B9MGP5
Position
1315898..1316782
AA seq 294 aa
MTANALPGHARAVWLMVAVTFMWSIAGVVTRHLDQARSFEVTFWRSFFMLLSLCVILPVL
QGRALLANLRRGGRAVWISGVCWSVMFTAFMIAILLIPVASVLVTMAIGPLLTALLARVF
IGHHIAPRTWCAIALAGAGIGWMYGSGISGLSVVGVLVALCVPVAAAVNWVVVQHSQRQG
HAVDLVPAVLLGAALSALATLPLAWPFQATARDLSLLALLGLVQLAIPCVLVVYCARVLK
APEIALLGLLEVIFGILLAWVGAGERPAPAVLMGGALVIGALVFNELLGWKEQQ
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaccgcgaatgctttgcccggccacgcgcgggcggtctggctgatggtggccgtcacc
ttcatgtggtccatcgcgggcgtcgtcacgcgccatctggaccaggcgcgcagctttgaa
gtgaccttctggcgcagctttttcatgctgctgtcgctgtgcgtgatcctgccggtgctg
cagggcagggcgttgctggccaatctgcggcgcggggggcgggcggtgtggatctctggc
gtgtgctggagcgtgatgttcacggccttcatgatcgccatattgctcatcccagtggcc
agcgtattggtcaccatggccatcggaccgctgctcacggcattgctggcgcgcgtcttc
attggccaccacatcgcgccgcgcacctggtgcgcgattgcattggcgggcgcaggcatc
gggtggatgtatggctcgggcatctccggcctgtccgtggtgggcgtgcttgttgccttg
tgcgtgccggtcgcggcggccgtgaactgggtggtggtgcagcactcgcagcgccagggc
catgcggtggacctggtgcccgccgtgctgctgggggcggcgctgtccgccctggccacg
ctgccgcttgcgtggccgttccaggccacggcgcgtgatttgtcccttctggccctgctg
ggtctggtccaattggcgatcccctgcgtgctggtggtgtactgcgcgcgcgtgctcaag
gcgcctgagattgcgctgctgggcctgctggaagtgatctttggcattctgctggcctgg
gtgggcgctggagagcgcccagccccggccgtgctgatgggaggcgcgctggtgatcggc
gcgctcgttttcaatgaactgcttggatggaaggaacaacaatga

DBGET integrated database retrieval system