KEGG   Acidovorax ebreus: Dtpsy_1252
Entry
Dtpsy_1252        CDS       T00853                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: ACM32719
UniProt: B9MGP6
Position
1316779..1317870
AA seq 363 aa
MTEMTAEVVTEVRGQVGCITLNRPKALNALSLGMVRDLMAALLAWQHDDKVLAVAIRGNG
REGPFGAFCAGGDIRFLHAAGSTGNPQLEDFFTEEYALNHLIHTFGKPYIAFMDGIVMGG
GMGISQGGTLRIVTERTKMAMPETAIGLFPDVGGGYFLSRCPGRVGEWLALTGDAIGAAD
AIDFGLADGFLPADQQAAVWDGLALQTFADGAAVQQWVASKFVAAGACAVSARGQIDHYF
ALDDAAAIVAALEQSDDEWARATAATLRKRSPLMLHVVLEQVRRARSMGLADDLRMERDM
VRHCFYLRPDQSETVEGIRALAVDKDHSPRWNPARVEDVEPALVQSFFKSPWPAHAHPLA
ALR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgacggagatgacggcggaagtcgtgaccgaggtgcgcggccaggtcggctgcatcacg
ctgaaccgcccgaaggcgctgaatgccttgtcgctgggcatggtgcgcgacctgatggcg
gcgctgctggcctggcagcatgacgacaaggtactggccgtggcgatccgcggcaacggt
cgcgaagggcccttcggcgccttctgcgcgggcggcgacatccgcttcttgcacgccgcg
ggcagcacgggcaatccgcaactggaggacttcttcaccgaggaatacgccctcaaccat
ctgatccacaccttcggcaagccctacatcgccttcatggacggcatcgtcatggggggc
ggcatgggcatcagccagggcggcacgctgcgcatcgtgaccgagcgcaccaagatggcc
atgccggagacggcgatcggcctgttccccgatgtgggcggcggctactttctctcgcgc
tgtcctggccgcgtgggcgagtggctggcactgacgggcgacgccatcggtgcagccgat
gccattgacttcggcctggcggacggcttcctgccagcggaccagcaagcggcggtgtgg
gacggtctggcgttgcagacgtttgccgacggcgctgccgttcagcagtgggttgcatca
aaatttgtagctgctggcgcttgcgctgtaagcgctagaggccaaattgatcactacttc
gcgttggatgatgcggcggccatcgtggctgcgctggagcagtctgacgacgagtgggca
cgcgccacggctgccacgttgcgcaagcgctctccactgatgctgcatgtcgtgctggag
caggtccgccgtgcgcgcagcatgggtctggccgacgacttgcgcatggagcgcgacatg
gttcggcactgcttctacctgcgtcccgaccagagcgagacggtggagggcattcgcgcc
ctggcggtggacaaggaccacagcccgcgctggaaccccgcgcgcgtggaggatgtggag
cccgcgctggtgcaatcgttcttcaagagcccttggccggcgcacgcgcacccgctggcg
gcgctgcgctga

DBGET integrated database retrieval system