KEGG   Acidovorax ebreus: Dtpsy_1254
Entry
Dtpsy_1254        CDS       T00853                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 HTH_Tnp_ISL3 HTH_AsnC-type DUF3780 Sigma70_ECF DUF134 HTH_24
Other DBs
NCBI-ProteinID: ACM32721
UniProt: B9MGP8
Position
complement(1318691..1319206)
AA seq 171 aa
MNRVQIVEQLPGLRRYARALTGDAWAADDLVQDTLERACRKWLLWRGGSNLRAWLFTLMH
NLYLNQRRGLVPVQAMDVEALAAIADAPDASHETALDLDRCLQRLPADQRAVLLLVTLED
MAYADVARVLGIPEGTVMSRLSRGRARMRELMEPSAPAQPSSTPTALRRMK
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaaccgcgtccagatcgtggagcaactgccggggttgcgccgctatgcgcgcgcgctc
accggcgacgcatgggcagccgacgatctggtgcaggacacgctggagcgcgcctgccgc
aagtggctgctgtggcgcggcggcagcaatctgcgcgcctggcttttcacgctgatgcac
aacctgtacctcaaccagcgccgcggcctggtgcccgtgcaggcgatggatgtggaggcc
ctggcggccatcgcggacgcgcctgacgcctcccacgaaacagccctggacctggaccgc
tgcctgcaacgcctgcccgccgatcaacgggccgtgctgctcctggtgacactggaagac
atggcctatgccgacgtggcgcgtgtgctgggtataccggaaggcacggtgatgtcgcgg
ttgtcccgcggtcgcgcacgcatgcgcgagttgatggagccctcagcccccgcccagccg
tcatccaccccgactgccttgcgccgcatgaaatga

DBGET integrated database retrieval system