KEGG   Acidovorax ebreus: Dtpsy_1255
Entry
Dtpsy_1255        CDS       T00853                                 

Definition
(GenBank) Secreted repeat of unknown function
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Lipoprotein_15
Other DBs
NCBI-ProteinID: ACM32722
UniProt: B9MGP9
Position
complement(1319223..1319588)
AA seq 121 aa
MTKLSSLLAALALAGCYSLAPAQVSTQDGVLVGPNGMTLYTFDKDVAGDGQSACNGACAT
NWPPLTATSAPAGEGYSLIQRADGSKQVAYKGKPLYYWIKDGKPGDKTGDGVNNLWRTAK
P
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaccaagctcagttccctgctcgccgcgctggcactcgccggctgttattccctcgcg
cccgcgcaagtcagcacccaggacggcgtgctcgtcggcccgaacggcatgacgctctac
accttcgacaaggacgtagcgggcgatggccagtcggcctgcaacggcgcctgcgccacc
aactggccacccctgaccgccaccagcgcccccgcgggtgaaggctacagtctgatccag
cgcgccgacggcagcaagcaggtggcctacaagggcaagccgctgtactactggatcaag
gacggcaagcccggcgacaagacgggggacggcgtgaacaacctgtggcgcaccgccaag
ccatga

DBGET integrated database retrieval system