KEGG   Acidovorax ebreus: Dtpsy_1256
Entry
Dtpsy_1256        CDS       T00853                                 

Definition
(GenBank) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Dtpsy_1256
SSDB
Motif
Pfam: SmpB
Other DBs
NCBI-ProteinID: ACM32723
UniProt: B9MGQ0
Position
complement(1319687..1320160)
AA seq 157 aa
MAKKPDTSSRIADNKKAAYNYFFEERYEAGLVLHGWEVKALREGKVQLTDGYVIIKDGEL
FLIGCQINPLKTASTHVSPDAARIKKLLMHKDEIRRLIGKVEQKGYTLVPLNLHWKDGRA
KCEIALAKGKAEHDKRDTIKEREGKREVERVMKSRHR
NT seq 474 nt   +upstreamnt  +downstreamnt
atggccaagaaacctgacacatcgtcccgcatcgccgacaacaagaaggcggcatacaac
tatttctttgaagagcgctacgaagcggggctggtgctgcacggctgggaggtcaaggca
ctgcgcgagggcaaggtgcagcttaccgacggctacgtgatcatcaaagatggtgagctg
tttctcatcggctgccagatcaacccgctcaagaccgcgtccacgcacgtcagccccgac
gcggcgcgcatcaaaaagctgctgatgcacaaggacgagatccggcgcctgatcggcaag
gtcgagcaaaaaggctacaccctggtgccgctgaatctccactggaaagacggccgcgcc
aagtgcgagattgcgttggccaagggcaaggccgagcacgacaagcgcgacaccatcaag
gagcgcgaaggcaagcgcgaggtggaacgcgtcatgaagagccgccaccgctga

DBGET integrated database retrieval system