KEGG   Acidovorax ebreus: Dtpsy_1258
Entry
Dtpsy_1258        CDS       T00853                                 

Definition
(GenBank) protein of unknown function UPF0125
  KO
K09801  uncharacterized protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Dtpsy_1258
SSDB
Motif
Pfam: Ub-RnfH
Other DBs
NCBI-ProteinID: ACM32725
UniProt: B9MGQ2
Position
1320708..1321052
AA seq 114 aa
MAETLPPPERLRIAVAISRQPGDVHEWVLLLPVGATVADALSACGLDAQAEGLVWGIWGR
EGRLDDLLHDGDRVEGCRPLRVDPKLARRQRFARQGARAAGLFAKRRPGAKSGY
NT seq 345 nt   +upstreamnt  +downstreamnt
atggctgaaaccttgcccccgccggagcggctgcgcatcgcggtggccatctcgcggcaa
ccgggcgatgtgcacgagtgggtgctactgcttccggtcggtgctacggtggccgatgct
ctgagcgcctgcggactggatgcacaggctgaggggcttgtctggggcatttggggcagg
gaaggcagactggacgacctgttgcacgatggtgaccgcgtggaaggctgccgccccttg
cgggttgacccgaagctggcgcgccgccagcgctttgcgcgccagggcgctcgtgcggcg
ggattgttcgccaaacgccggccgggggccaagtccggttattga

DBGET integrated database retrieval system