KEGG   Acidovorax ebreus: Dtpsy_1260
Entry
Dtpsy_1260        CDS       T00853                                 

Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
dia  Acidovorax ebreus
Pathway
dia00230  Purine metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
Module
dia_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dtpsy_1260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dia04147]
    Dtpsy_1260
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     Dtpsy_1260
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dtpsy_1260
  Exosomal proteins of breast cancer cells
   Dtpsy_1260
SSDB
Motif
Pfam: IMPDH NMO CBS FMN_dh His_biosynth Glu_synthase Peptidase_S29 DHO_dh G3P_antiterm ThiG
Other DBs
NCBI-ProteinID: ACM32727
UniProt: B9MGQ4
Position
1321740..1323215
AA seq 491 aa
MRLLGKALTFDDVLLVPAYSQVLPKDTSLVTRFTRNITLNLPLVSAAMDTVTEARLAIAI
AQEGGIGVIHKNMTAEQQAAEVSKVKRHESGVVHDPVVITPEHTVLQVLELSENLGISGF
PVCDGGKVVGIVTSRDVRFETRYDVKVREIMTPREKLITVNEKDGTTPAQAKALLNRHKL
ERLLVVNDAFELKGLITVKDINKQTTFPNAARDAAGRLRVAAAVGVGAGTEERVALLVKA
GVDAIVVDTAHGHSKGVIDRVRWVKQNYPQVDVIGGNIATGAAALALAEAGADAVKVGIG
PGSICTTRIVAGVGVPQIMAIDSVATALQGTGVPLIADGGIRFSGDIAKALAAGASTIMM
GGMFAGTEEAPGEVILYQGRSYKSYRGMGSIGAMQQGSADRYFQEATTGNPNADKLVPEG
IEGRVPYKGSMVSIVFQMAGGVRAAMGYCGCATIEEMNNKAEFVEITAAGIRESHVHDVQ
ITKEAPNYRAD
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcgccttcttggaaaagcgctcaccttcgacgatgtgttgttggtgccggcgtactcc
caggtcctgcccaaggacacctccctcgtcacgcgctttacgcgcaacatcaccctgaac
ctcccgctcgtgtccgccgccatggacaccgtgaccgaagcgcgtctggccatcgccatc
gcgcaagaaggggggattggcgtcatccacaagaacatgacggccgagcagcaggcggcc
gaggtgtcaaaggtcaagcggcatgagtccggcgtggtgcacgatcccgtggtcatcacg
cccgaacacacggtgctgcaggtgctggaactgtccgagaacctgggcatctcgggcttc
ccggtctgtgatggtggcaaggtggtgggcatcgtcaccagccgcgacgtgcgcttcgag
acgcgctacgacgtcaaggtgcgtgagatcatgacgccgcgcgagaagctgatcaccgtc
aacgaaaaagacggcaccaccccagcccaggccaaggcgctgctcaaccgccacaagctg
gagcgcctgctggtggtgaacgacgcctttgagctcaagggcctcatcacggtcaaggac
atcaacaagcagaccacgttccccaacgccgcgcgcgatgcggcaggccgcctgcgcgtg
gccgctgccgtgggcgtcggcgcgggcaccgaagagcgcgtggcgttgctggtcaaggcc
ggtgtggatgccatcgtggtggatacagcccacggccacagcaaaggtgtgatcgaccgc
gtgcgctgggtcaaacagaactacccgcaggtggacgtgatcggcggcaacatcgccacc
ggcgctgccgcgctggccctggccgaggcaggcgccgatgcggtcaaggtcggcatcggt
cccggctccatctgcaccacacgcatcgtggctggcgtgggtgtaccccagatcatggcc
atcgacagcgtcgccaccgcgcttcagggcacaggggtgccgctgatcgccgatggcggc
atccgcttctcgggggatattgccaaggcgctggccgcgggcgcgtcgaccatcatgatg
ggcggcatgtttgctggcaccgaagaagcgcccggcgaagtcatcctgtaccagggccgc
tcctacaaaagctaccgtggcatgggctcgatcggcgccatgcagcagggctcggccgac
cgctacttccaggaagccaccacgggcaatcccaacgccgacaagctggtgcccgaaggc
atcgaaggccgcgtgccctacaagggctccatggtgtccatcgtgttccagatggccggc
ggcgtgcgtgcggccatgggctactgtggttgcgcaaccatcgaagagatgaacaacaag
gccgaattcgtggagatcacggcggctggcatccgcgagtcgcacgtgcacgacgtgcag
atcaccaaggaagcccccaactaccgggcggactga

DBGET integrated database retrieval system