KEGG   Acidovorax ebreus: Dtpsy_1263
Entry
Dtpsy_1263        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32730
UniProt: B9MGQ7
Position
1326528..1326803
AA seq 91 aa
MARPSHPKKEVEEALRHAEGQGWRVEVGGSHAWGRIYCPYNDAECRCGEFCITSVWSTPK
NPGNHARALRRVVDNCTTHRKQQEAADDAEE
NT seq 276 nt   +upstreamnt  +downstreamnt
atggcccggccctctcatccgaagaaagaagtcgaggaagcactcaggcacgccgaaggg
cagggctggcgcgtggaagtcggtggcagccacgcctgggggcggatttattgtccgtac
aacgatgcggagtgtcgctgcggcgagttctgtatcaccagcgtgtggagtacgccgaag
aacccaggcaaccatgcgcgcgccttgcggcgagtcgtggacaactgcacgacgcaccgc
aagcagcaggaggcagccgacgatgccgaggaatag

DBGET integrated database retrieval system