KEGG   Acidovorax ebreus: Dtpsy_1265
Entry
Dtpsy_1265        CDS       T00853                                 

Definition
(GenBank) phage transcriptional regulator, AlpA
  KO
K07733  prophage regulatory protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dia03000]
    Dtpsy_1265
Transcription factors [BR:dia03000]
 Prokaryotic type
  Other transcription factors
   Others
    Dtpsy_1265
SSDB
Motif
Pfam: Phage_AlpA HTH_17 NUFIP1
Other DBs
NCBI-ProteinID: ACM32732
UniProt: B9MGQ9
Position
complement(1327347..1327730)
AA seq 127 aa
MEFEVNNPSHLSNVLDTALDQSLPLPGTEAYEALPQFPKRSPLPFRRTIRRHELRQIVPL
AETTIYEMERRGEFPRRFNLTPRCVVWDLAEVEAWIEERKQAPRISAAKPDVHLRKTRPV
RAGSGQD
NT seq 384 nt   +upstreamnt  +downstreamnt
atggagttcgaggtgaacaatccatcgcacctatccaatgtgctcgacaccgcccttgac
cagtctcttcccttgcccgggacggaagcttatgaagcgctgcctcagtttccgaagcgc
agcccgcttcccttccgccgcaccatccgccgccacgagttgcgtcagatcgtccccttg
gccgaaacgacgatctacgaaatggagcgtcgcggcgagttcccacggcgtttcaatctc
acgccgcgctgcgtggtatgggacctggccgaggtggaggcctggattgaggagcgcaag
caagcccctcgcattagcgccgccaagccggatgtccacctgcgaaaaacccgccctgtt
cgggcgggttccggtcaggattga

DBGET integrated database retrieval system