KEGG   Acidovorax ebreus: Dtpsy_1266
Entry
Dtpsy_1266        CDS       T00853                                 

Definition
(GenBank) Domain of unknown function DUF1863
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF1863 TIR_2
Other DBs
NCBI-ProteinID: ACM32733
UniProt: B9MGR0
Position
1327999..1328466
AA seq 155 aa
MADKRNVFISHVHKDDHGLQKLKDLLAPKGVEVRDSSIHTGKFNNATDEHYIKTQILAPA
INWAGVFICYVSPQTKNSDWVNWEIEYAAKQGKRIVGVWEHGEKECDLPDALKEHADALV
GWNGDSIIDAINGKDSWEKPDGGACDPVSLKRHPC
NT seq 468 nt   +upstreamnt  +downstreamnt
gtggcagacaaaaggaatgtattcatcagccatgtccataaggacgatcatgggctccag
aagctcaaggatttgttggcgccgaaaggggtggaagtccgggattcctccatccacaca
ggaaaattcaacaatgccactgatgagcactacatcaagacgcagatccttgcgcctgcc
atcaattgggctggggtgttcatttgctacgtctcaccccaaaccaagaacagcgattgg
gtgaactgggaaatcgaatatgcggccaaacaaggcaagcgcatcgttggtgtttgggag
cacggcgaaaaggaatgcgacctgccggatgcgctaaaagaacatgcggacgccttggtt
gggtggaacggtgattcaatcattgacgcgatcaacggcaaggattcgtgggaaaagcct
gacggcggtgcctgtgatccggtttcactcaagcggcatccctgctga

DBGET integrated database retrieval system