KEGG   Acidovorax ebreus: Dtpsy_1267
Entry
Dtpsy_1267        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Nmad2
Other DBs
NCBI-ProteinID: ACM32734
UniProt: B9MGR1
Position
1328466..1329092
AA seq 208 aa
MTRIHSYVVRYDSGFAPNPFYSYCTLATCKPSIRRSADIGDWVVGSGSNDRSVRRGGHLV
YAMRVTEAMTFDEYGRDPRFESKKPYRNGSRKQSCGDNIYFRAAAGVAWQQRDSFHSRPD
GSLNPDHVARDTGVNRVLISNDFVYFGGEGPAFPDELQDQQGRPLCKTGIGLTAFDDAQL
VGNLEQWIRNLAVSGYQGAPFEWLTLRR
NT seq 627 nt   +upstreamnt  +downstreamnt
atgacacgcattcactcctatgtcgtgcggtacgacagtggttttgcgcccaaccccttc
tacagctactgcacgctcgcgacttgcaagcccagtattcgaagaagcgctgacatcggt
gattgggtggtcggcagcggaagcaatgatcgaagtgttcgacgcggtgggcatctggtc
tatgcgatgcgggtcaccgaggcaatgacatttgatgagtacggccgagacccgcggttt
gaatccaagaagccgtaccgcaatggcagtcggaagcaaagttgtggggacaatatttat
ttcagggctgcggctggggttgcttggcagcagcgagactcatttcactcccgccccgat
ggctcgctcaaccctgaccatgtggcccgtgatacaggcgtcaacagggttctgatcagc
aacgatttcgtatatttcgggggtgagggccctgcgtttcctgatgaattgcaagatcag
caaggtcgccctctatgcaaaacgggaataggcctcacggcctttgacgatgcgcaatta
gttggaaatcttgagcaatggattcgcaacttggcagtgagcggctaccaaggcgcccca
ttcgaatggctgactcttcgcaggtga

DBGET integrated database retrieval system