KEGG   Acidovorax ebreus: Dtpsy_1269
Entry
Dtpsy_1269        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: ACM32736
UniProt: B9MGR3
Position
1330229..1330891
AA seq 220 aa
MKIHPFVEAVASLQFEDCFNPYSDRCEVHDRRDAPRRRAAALSAMLRRATEEPVDAIWIG
RDLGYRGGRRTGLALTDDVHMSQHAKRWNLDLIAERPTIGSAVAERTAAVIWGMLEHIDA
RIFLWNVFPLHPHESGDPFTNRQHNAHERRAGEELLQQLIVLLKPSRIVAIGNDATAAAH
RITDSVPVICVRHPSYGGQTQFQTQISELYGHPMSTGSLF
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaagatccacccattcgttgaggcagttgcttcgctgcaattcgaagactgcttcaat
ccgtattcggatcgatgtgaagtccatgatcggcgcgatgcgccgcgtcgccgtgctgca
gcactttccgccatgttgcgtcgtgcaaccgaggagcccgtagatgcgatctggatcggg
agagacctcggatatcgcggagggcgccgaactgggctagccctgactgacgacgttcac
atgagccagcacgccaagcgctggaatctcgatctgatcgctgaacggccgacgatagga
agtgctgttgctgaacgaaccgcggcggtcatatggggcatgctggaacacattgatgcc
cgcatcttcctctggaatgtctttccccttcatccgcatgaatctggagatccattcacc
aaccgccagcacaacgcgcacgaaagacgcgccggcgaagaactgcttcaacaactcatt
gtcttgctgaagccttctcgcatcgttgccatcggcaatgatgccaccgctgcggcccat
cgcatcacggattctgtaccggtgatttgcgtgaggcaccctagctatggaggacagaca
cagttccagacgcaaatctcggaactctatgggcacccaatgagtaccggatcattgttt
tga

DBGET integrated database retrieval system