KEGG   Acidovorax ebreus: Dtpsy_1270
Entry
Dtpsy_1270        CDS       T00853                                 

Definition
(GenBank) Domain of unknown function DUF1863
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF1863 TIR_2
Other DBs
NCBI-ProteinID: ACM32737
UniProt: B9MGR4
Position
complement(1330908..1331393)
AA seq 161 aa
MPRKVFYSFHYQRDSWRASKIRNIGVVEGNPSASDNKWEEVKRGGDAAIKCWIDDQLQGR
TCTIVLVGAETANRPWIRYEIEQSWNSGKGLLGIRIHKLLDHNQQPSVAGANPFDSFTLN
DGRKLSSVVRVYDPLGGTSSAVYTSISDNLSSWIEAAIAAR
NT seq 486 nt   +upstreamnt  +downstreamnt
atgccacggaaagttttctacagctttcattatcaacgcgacagttggcgcgcatccaag
atacgcaatattggggttgtagagggcaacccgtcagcgagcgataataaatgggaagaa
gtgaagcgaggcggtgatgccgcgatcaagtgctggattgacgatcaattgcaagggcgg
acttgcacaattgttttggttggtgcggaaacggcaaatcgcccctggattcgatatgag
attgagcagtcatggaacagcggaaagggactcttggggatacgtatccacaagctcttg
gaccacaaccagcaaccatcagtggcaggggccaatccgttcgactcatttaccttgaac
gacggtagaaagctatcctccgtcgtccgcgtctacgatccgctgggaggtaccagtagc
gcggtctatacctccatcagcgacaacctgtcgagttggatcgaagcagcgatcgccgca
cgctag

DBGET integrated database retrieval system