KEGG   Acidovorax ebreus: Dtpsy_1271
Entry
Dtpsy_1271        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: LD_cluster3
Other DBs
NCBI-ProteinID: ACM32738
UniProt: B9MGR5
Position
complement(1331440..1332027)
AA seq 195 aa
MSAIFLSASVPLVGRGTYHETANPFLIQCAVRELVIAVIRQHKIVWGGHPAITPMIWSIC
EDLGVDYSQSVVLYQSTFFADAFPEENKHFQNVVFTDAVPNDRAASLLVMREKMLSRADL
SAAVFIGGMDGVEAEHELFRRFHPAAKVLPVSSPGGAALNLAKDHGYFTGGALVDVDFAQ
LFHAHLAVPLAGKLS
NT seq 588 nt   +upstreamnt  +downstreamnt
atgagtgcaatcttcctctcggccagcgtgccacttgttggacgtggcacttaccacgaa
actgccaatccatttctcatccaatgtgcggtgagagaactggtcatagcagtcattcgc
cagcacaagatcgtatggggtgggcatcctgcgattaccccgatgatttggagcatatgt
gaagacttaggcgtcgattactcacagtctgtcgtcttatatcagagcacgttctttgca
gatgcgttccctgaagagaacaaacattttcagaatgtagttttcactgatgctgtcccc
aatgacagggctgcgagcttgcttgtcatgcgtgaaaagatgctctcgcgtgcggaccta
agcgctgctgtgtttattggtggaatggatggggtagaagccgagcatgagcttttcagg
cgattccatcctgcagccaaggtgctcccggtatcttcgccgggcggagcggcgctgaat
ctagccaaggaccatggctattttaccggtggagcgctcgttgatgtggacttcgctcag
ctcttccatgcgcacttggcggtgcccttggctggcaaactgagttaa

DBGET integrated database retrieval system