KEGG   Acidovorax ebreus: Dtpsy_1273
Entry
Dtpsy_1273        CDS       T00853                                 

Definition
(GenBank) DNA repair protein RadC
  KO
K03630  DNA repair protein RadC
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Dtpsy_1273
SSDB
Motif
Pfam: RadC Prok-JAB
Other DBs
NCBI-ProteinID: ACM32740
UniProt: B9MGR7
Position
1333561..1334067
AA seq 168 aa
MSQLSLSLDSSLLVRDAQGRYLLASADQILAAARQVIDQKNPRGTLFTSPALVKDYLRTK
LASFEHEVFAALFLDSQHRLIEYVELFRGTIDQASVYPREVVKEALRLNAAAVVFSHNHP
SGSPEPSQADRVLTQRLKEALALVDVRTLDHIVVGGAVTTSFAECGLL
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcgcaactttctctgtctctcgattcttcgctgctggtgcgtgacgcgcaggggcgt
tacctgctggcgtcggcggaccagattctggcggcggcacgccaggtcatcgaccagaag
aacccacgcgggacgctgttcacttcgccggcgctggtcaaggactaccttcgcaccaag
ctggccagcttcgagcacgaggtcttcgcggcgctgttcctagacagccagcatcggctg
atcgagtacgtggaactgttccgcggcaccatcgaccaggcatcggtgtatccgcgcgag
gtcgtgaaggaggcactgcggctcaacgcggcagcggtggtcttttcgcacaatcatccg
agcgggagtcccgagccgagccaggccgacagggttctgacccagcgcctcaaggaagcc
ctggcgctggtggacgtgcgcacgctggatcacatcgtcgtcggcggcgcggtcaccacg
tcattcgccgaatgtggcctactctga

DBGET integrated database retrieval system