KEGG   Acidovorax ebreus: Dtpsy_1274
Entry
Dtpsy_1274        CDS       T00853                                 

Definition
(GenBank) putative transposon
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF2958
Other DBs
NCBI-ProteinID: ACM32741
UniProt: B9MGR8
Position
1334344..1334694
AA seq 116 aa
MNNALITDEQRAMLLANGRESLENPDFDPAPVVKLFTPDAGATWLLTEIDPDDHDHAFGL
CDLGVGMPEIGWVSLGELATVRGGLGLPIERDLSFQAEKRLSAYARDARLAGRIVQ
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaacaacgcactcatcactgacgagcagcgcgcgatgctgctggccaacggccgcgaa
tctttggaaaacccggacttcgacccggcccctgtggtcaagctgttcacgccagatgct
ggcgcgacctggctgctgaccgagatcgatcccgatgaccacgatcacgccttcgggttg
tgcgacctgggcgtggggatgccggaaatcggctgggtcagcttgggcgaactggcgacc
gtgcgcggcgggctgggcctgccaatcgaacgcgacctgtctttccaggccgaaaagcgg
ttgagcgcctatgctcgcgatgcgcgcctggccgggcgaatcgttcaatga

DBGET integrated database retrieval system