KEGG   Acidovorax ebreus: Dtpsy_1275
Entry
Dtpsy_1275        CDS       T00853                                 

Definition
(GenBank) hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32742
UniProt: B9MGR9
Position
complement(1334723..1335388)
AA seq 221 aa
MEETIINNDPLEHMLHRSNTLHERLDELLGDADFDGSPRGESTLGMCLVAMEHAAAMRAL
MSLRLPTSAVGLMRLQFEALTRAMWLLYAASDAAIDKLLAPLTQQSEQAAKNLPGASEMI
EQIGKRVGQGAPAAAHQMLLHFKDVTWHGMNSFVHGGIHPLRRSADGFPVDLALQVLRSS
NGLTTMTGMTMAVLTGDEAVAKPVSKIQPAFADCLPALLRP
NT seq 666 nt   +upstreamnt  +downstreamnt
atggaggaaaccatcatcaacaacgacccgttggagcacatgctccaccgttccaatacc
ttgcacgagcggctggatgaactgctgggcgatgccgatttcgatggatcgccccgcggc
gaatcaaccctcggcatgtgcttggtcgctatggaacatgcggcggcaatgcgagcattg
atgtcgctgcgactgcccacgtctgccgtcggcctcatgcgcctgcagttcgaggccctg
acacgggcaatgtggctgctctacgcagctagcgacgcagcgatcgacaagttgctggcg
ccactgacgcagcagagcgaacaggcagccaagaacttgcctggcgccagcgaaatgatt
gagcagatcggcaagcgagtcggacaaggcgcgccggcagccgcgcaccagatgctgttg
cacttcaaggatgtgacctggcacggcatgaactcattcgtgcatggcggcattcatccg
ctgcggcgtagtgccgacggcttcccggtcgatcttgcgctgcaagtgctgcgcagctcg
aacggtctgacgaccatgaccggcatgacgatggctgtcctcaccggcgatgaagccgtg
gccaagcccgtgagcaagatccagccggcattcgccgactgcctgccggctctgctgaga
ccttga

DBGET integrated database retrieval system