KEGG   Acidovorax ebreus: Dtpsy_1276
Entry
Dtpsy_1276        CDS       T00853                                 

Definition
(GenBank) protein of unknown function DUF932
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF932
Other DBs
NCBI-ProteinID: ACM32743
UniProt: B9MGS0
Position
1335912..1336736
AA seq 274 aa
MQLASRFASRSPALRSDYPLSDDQIRRVAPSIFADAPHESRSERYSYIPTATVLQELRGE
GFEPFMVTQTRVRHDDRRDYTKHMIRLRHASQINGREANEIILLNSHDGTSSYQMLAGMF
RFVCSNGLVCGDTVADVRVPHKGDVAGHVIEGAYEVLHGFDRAQESRDAMCAITLDEGEA
EVFARAALALKYDEDKPAPITESQILMPRRHDDDRRDLWSVFNRTQENLTKGGLSARAAN
GRRQTTRPVQGIDQSVRLNRALWLLADGLRQLKA
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcaactcgcatcccgtttcgcttcccgctccccggcactgcgcagcgattacccactg
tccgatgaccaaatccgcagggtggccccgtccatcttcgccgacgccccgcacgaaagc
cgctccgagcggtacagctacatccccaccgccacggtgttgcaagaactgcgcggggaa
ggcttcgagcctttcatggtgacgcagacccgcgtgcgccacgacgaccgccgcgactac
accaagcacatgatccggctgcgccacgccagccagatcaacggccgcgaggccaacgaa
atcatcctgctgaactcccatgacggcaccagcagctatcagatgctggccgggatgttc
cgcttcgtttgcagcaatggccttgtctgcggcgacaccgtggccgacgtgcgcgttccc
cacaagggcgacgtggccgggcacgtcatcgaaggcgcttacgaagtcctgcacggcttc
gaccgggcgcaggaatcccgcgatgccatgtgcgcgatcacgctggatgaaggcgaagcg
gaagtgttcgcccgcgctgcgctggcgttgaagtacgacgaggacaagcccgcgcccatc
acggaatcgcaaatcctgatgccgcgccgccacgacgacgaccgccgcgatctgtggagc
gtgttcaaccgcacgcaggagaacttgaccaaaggcggcctgtccgcccgcgccgcgaat
ggccgccgccagaccacccggcccgtgcagggcatcgaccaaagcgtgcgcctgaatcgc
gccctgtggctgctggccgatggcctgcgccagttgaaagcctga

DBGET integrated database retrieval system