KEGG   Acidovorax ebreus: Dtpsy_1277
Entry
Dtpsy_1277        CDS       T00853                                 

Definition
(GenBank) ParB domain protein nuclease
  KO
K03497  ParB family transcriptional regulator, chromosome partitioning protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dia03000]
    Dtpsy_1277
   03036 Chromosome and associated proteins [BR:dia03036]
    Dtpsy_1277
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dia04812]
    Dtpsy_1277
Transcription factors [BR:dia03000]
 Prokaryotic type
  Other transcription factors
   Others
    Dtpsy_1277
Chromosome and associated proteins [BR:dia03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Dtpsy_1277
Cytoskeleton proteins [BR:dia04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Dtpsy_1277
SSDB
Motif
Pfam: ParBc Seryl_tRNA_N LidA_Long_CC BPS1 FemAB ALS2CR11 PspB
Other DBs
NCBI-ProteinID: ACM32744
UniProt: B9MGS1
Position
1336817..1338886
AA seq 689 aa
MNAMIQTEARAVNTAAAAPLEAADPTKNLILVPLSRLVLRPTGRNVRKAPRMSIPELAAS
IQRVGLLQNLIVIASADGEHYEVVAGGRRLAALKLLAKKRRISKEWEVPCLLVADGTART
ASLTENVQREAMHPADQFEAFAALVAEGRPIEDIAADFSVTPLVVQRRLKLANVSPRLMA
DYRVDAVSLEQLMALAIIDDHAAQEAAFYDAPQWQRQPSALRERLTEREIDAYRHPLVRF
VGLDTYEAAGGGVRRDLFAEGNAGVYLTDAALLERLAQDRLAGIAATVRAEGWVWVDAAP
GVTHADLHAFQRAPRERREPTKREAQRIGKLQAKLNELAEAVDAALDAEDEDKADALQEE
GEALGEQLQTLEDGLQDYSPNVKAAAGAIVTIDRNGEAVIHRGLMREAEAKALRTLERLR
QGFGGEDTGNDDEGEDADDAPKAAAMSDRLAQRLSTHRTAALQIEVARHPQVALAALVHG
MVQKVLQASHYGNDLPLGVRLTVQDRLEGMAPDWPESPAAVALRELQQVAGEGLPEDNAE
LFAALLAKPQDELVKLLAVCVASTVDVVTPRATPRQPGAELVQAVGLDMAAWWKPTAEGY
FKHVPKATILQAVGEYAPEHVTRLAKLKKADIASEAERLADSTGWMPAIFKTEGPQQAVQ
ESAQEEGPEQEAPDDAEAGADEPAEALAA
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgaacgccatgattcaaaccgaagcccgcgccgtcaacaccgccgccgctgccccgctg
gaagccgccgacccgaccaagaacctgattctggttccgctgtcgcggctggtgctgcgt
ccgacgggccgcaacgtgcgcaaggccccgcgcatgtcgattcccgaactcgccgccagc
atccagcgtgtgggcctgctgcaaaacctgatcgtgattgcatccgctgatggcgagcat
tacgaagtcgtcgccggtggccgtcgccttgccgcgttgaagctgctggcgaagaagcgc
cgcatcagcaaggaatgggaggtgccttgcctgctggtagccgatggcaccgcccgcacc
gccagcctcaccgagaacgtgcagcgcgaagccatgcacccggcagaccagtttgaagcg
ttcgcggcgctggtggccgaaggccggcccatcgaagacattgctgcggatttttccgtc
acgccgctggtggtgcagcgccgcttgaagctggcgaacgtctcgccacgcctgatggcg
gactaccgggtcgatgccgtgagccttgaacagttgatggcccttgccatcatcgacgac
cacgccgcgcaggaagccgcgttctacgatgcgccccaatggcagcgccaaccttccgcg
ctgcgcgaacgcctgaccgagcgggaaatcgacgcctaccggcatccgctggtgcgcttc
gtcgggctggacacctacgaggccgcaggcggtggcgtgcgccgcgacctgttcgcggaa
ggcaatgcgggcgtgtatctgaccgacgccgcgctgctggaacggctggcgcaagacagg
ctggcgggcattgccgccacagttcgcgccgagggctgggtatgggtggacgccgcgccc
ggcgtgacccatgccgacctgcacgctttccagcgtgccccgagggagcggcgcgaaccg
accaagcgcgaagcgcagcgcattgggaagctgcaagccaaactgaacgaactggccgaa
gccgtggatgccgcgctggacgccgaggacgaggacaaggccgacgcgctgcaagaggaa
ggcgaagccctgggcgagcagttgcagacgctggaagatggcttgcaggactacagcccg
aacgtgaaggccgcagccggtgccatcgtcaccatcgaccgcaacggcgaggccgtgatt
catcgcgggctgatgcgcgaggccgaggccaaggcgctgcgcacgctggaaaggttgcgg
cagggtttcggcggcgaggataccgggaacgacgacgaaggcgaggatgccgacgacgcg
cccaaggccgcagccatgtccgaccggctggcgcagcgcttgagcacccatcgcacggcg
gcgctgcagatcgaggtggcacggcatccgcaggtcgcgctggctgcgctggtgcatggc
atggtgcagaaggtcttgcaggctagccactacgggaatgacttgccgctgggcgtgcgc
ctcacggtgcaagaccggctggaaggtatggccccggactggccggaatcgcctgccgcc
gtggcgctacgcgaattgcaacaggtggcgggcgaaggcttgcctgaggacaacgccgaa
ctgttcgccgcgctactggcaaagccgcaagacgaactggtcaagctgctggccgtgtgc
gtggcttccacggtggacgtggtgacgcctcgcgccacgccacgccagcccggcgcggaa
ttggtgcaggccgtgggcctcgacatggccgcatggtggaagccgaccgccgaggggtat
ttcaagcacgttccgaaggccacgatcctgcaagccgtgggcgagtacgcgcccgagcac
gtcacccggctggcgaagttgaagaaggccgacattgccagcgaggccgagcggctggcc
gacagcacgggctggatgcctgccatctttaagaccgaaggcccgcagcaggcagtgcag
gaaagcgcgcaagaggaaggcccggagcaggaggccccggacgatgccgaagccggggcg
gatgaacccgccgaggcgctggccgcttga

DBGET integrated database retrieval system