KEGG   Acidovorax ebreus: Dtpsy_1282
Entry
Dtpsy_1282        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: EF-hand_7
Other DBs
NCBI-ProteinID: ACM32747
UniProt: B9MGS4
Position
complement(1341773..1342621)
AA seq 282 aa
MIHVMAKVNFFDKRVIKKFLEITAVVSGTLSFVVIFVDIPAEWKLKAGLAFLAVQALTYL
VIWLWSNNLNSIDINVEGSDVAIKTGDIFRQPGLKAIAFNEYFDTQVDNKIIGETSLNGV
FIQKHLGVPLSELDRHIEEYAFDNSEVLDENETRKQGKKKRYQIGTICLYKDYLLTAFSK
FDENNKALLTMPEYLEFLINFWDKVNNVYAQQSVSTTIFGSGITRIKGHKNISDEDLLKI
MLWTFRISEMRFKYPAKLTIVIHKDKIDQINLLDIRSARNGV
NT seq 849 nt   +upstreamnt  +downstreamnt
atgatccacgtcatggcgaaggtcaacttttttgacaaacgggtcatcaagaaattcctt
gaaatcaccgctgtcgtcagcggtacgctgtcattcgtagttatttttgttgacatccct
gccgagtggaagctgaaggctggcttggctttcctggcagtacaggcactcacctacttg
gtgatatggctctggtcgaacaacctgaacagtatcgacatcaatgtcgagggcagcgat
gtagcgatcaagactggcgacattttccggcagcctggattgaaggccatcgccttcaat
gagtatttcgacacgcaggtggacaacaagataattggcgagacttccctcaacggcgtt
ttcatccagaagcatctcggcgtcccgctctccgaactggaccgccacatcgaggaatac
gcttttgataacagcgaagtcctggatgagaacgaaaccagaaaacaggggaagaagaaa
agatatcagataggcacgatctgcctgtacaaagactacctcctgaccgcattctccaaa
ttcgacgagaacaacaaggcgctgctgacgatgccagagtaccttgagtttctcatcaat
ttctgggacaaggtaaacaacgtctacgctcagcaaagcgtatcgaccacgatcttcggt
tcgggaatcacgcggatcaaaggacacaagaacatttccgacgaggatctcctgaagata
atgctgtggacgttcaggatcagcgaaatgcgattcaagtatcccgcgaagctgaccatc
gtgatccacaaagacaagattgaccaaatcaatcttctcgacattagatccgctaggaac
ggcgtgtaa

DBGET integrated database retrieval system