KEGG   Acidovorax ebreus: Dtpsy_1283
Entry
Dtpsy_1283        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF1863 TIR_2 TIR
Other DBs
NCBI-ProteinID: ACM32748
UniProt: B9MGS5
Position
complement(1342643..1343206)
AA seq 187 aa
MTYRNGNYTAFYVAEPFHPSSLGANATKDFQYYNTLRMWKGADATFPFVDSHDKTYSVRD
GSDWESTLKPRLRERLRNSKNIILILSSITTNSRALREEIDYGINDQGLPIIVVYPEYAT
KESLLVGGSLKQAVKNLWENLPVFRDSMSKVPTLHVPMNKELIKKSLQDGEFMVGSVKAP
GIYRYNP
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacatatcgaaatggaaactacaccgccttctacgttgcggagccattccatcccagc
tcgctgggtgccaatgcgacaaaagattttcaatactacaacaccctgcggatgtggaaa
ggcgctgatgcgacgtttcccttcgtcgattcgcacgacaaaacttacagcgtccgcgac
ggcagcgattgggaatccaccctgaagccgagactcagggagcgccttcggaactcgaag
aacatcatcctcatcttgagttcgatcacgacgaattcccgcgcccttcgagaagaaatc
gactacgggatcaacgaccaggggctgcccatcatcgtcgtctaccccgaatatgccact
aaggaaagcctgctggtcggtggatcattgaagcaggcggtcaagaacctgtgggaaaat
cttcccgtgttccgggattcgatgagcaaagtccctacgcttcatgtcccaatgaataag
gaactcatcaagaaatccttgcaggacggcgagttcatggttgggagcgtgaaggcccct
ggcatctacagatacaacccgtaa

DBGET integrated database retrieval system