KEGG   Acidovorax ebreus: Dtpsy_1284
Entry
Dtpsy_1284        CDS       T00853                                 

Definition
(GenBank) helix-turn-helix domain protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19
Other DBs
NCBI-ProteinID: ACM32749
UniProt: B9MGS6
Position
complement(1343215..1343505)
AA seq 96 aa
MAAQYSLAKALKAVRKARGLSQEAFSDVSSRTYMSTLERDLKSPTLNKLAELCEVMEIHP
LTLLTLAYAGDSTRKADELLAQVRQELEAVLNSDGD
NT seq 291 nt   +upstreamnt  +downstreamnt
gtggcggctcagtactcattggcgaaggctttgaaggcagtcaggaaagcgcgtggcttg
agccaagaagcgttttcggacgtgtcgagccgcacctatatgagtaccctggagcgcgac
ctcaaaagcccgacccttaacaaactggccgagctgtgcgaggtgatggagatccacccg
ctcacgctgttaacgctggcttacgcaggcgacagcacgcgcaaggctgacgagttgctg
gcgcaggttcgccaggaacttgaggcggtattgaattcagatggagattga

DBGET integrated database retrieval system