KEGG   Acidovorax ebreus: Dtpsy_1285
Entry
Dtpsy_1285        CDS       T00853                                 

Definition
(GenBank) putative lipoprotein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF2958
Other DBs
NCBI-ProteinID: ACM32750
UniProt: B9MGS7
Position
1343748..1344098
AA seq 116 aa
MPQPLATDPERAQLLANGEARAAGEAIDPMPVVRLFTPDAHVTWLLAALDPADGDTAWGL
IDLGIGMPAQGTVKLSELAGIVGPRQQPVLRDLYFRPTRTLSEYTRLAERDGAIPD
NT seq 351 nt   +upstreamnt  +downstreamnt
atgccccagccgcttgccaccgacccggagcgcgcgcaactgctcgccaacggcgaggcc
cgtgccgctggcgaggccatcgacccgatgcccgtggtgcgcctgttcacgccggacgcg
catgtgacctggctgctggcggcgctcgacccggccgatggcgacaccgcctggggcctc
atcgacctggggatcgggatgccagcgcagggcactgtcaagctgtccgagctggccggc
atcgtcgggccgcgccagcagcccgtgctacgcgacctctatttccgtcccacgcgcacg
ctgtcggaatacacccggctggccgagcgcgacggagcgatcccggactga

DBGET integrated database retrieval system