KEGG   Acidovorax ebreus: Dtpsy_1287
Entry
Dtpsy_1287        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: HTH_17 HTH_Mga
Other DBs
NCBI-ProteinID: ACM32752
UniProt: B9MGS9
Position
1345251..1345532
AA seq 93 aa
MRPAPLRPAATVSTAAAQPQRYLTNDEAAEYLRLSPRTLEKQRVIGGGPRFRKFGRRVMY
AVADLDAWAADRSFETTSDPEYAEHHSADSRDR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcgtcccgctcccttgcggcctgccgccactgtctcgaccgctgccgcgcagccccaa
cgctatctcaccaacgacgaagccgccgagtacctgcggctgtcgccgcgcacgctggaa
aagcagcgcgtgatcggtggtgggccgcgctttcgcaagttcggccggcgcgtgatgtac
gccgtggccgacctcgatgcctgggccgccgaccgcagtttcgagacgacttccgatccc
gaatacgccgagcaccactcggccgacagccgtgaccgctga

DBGET integrated database retrieval system