KEGG   Acidovorax ebreus: Dtpsy_1289
Entry
Dtpsy_1289        CDS       T00853                                 

Definition
(GenBank) Cobyrinic acid ac-diamide synthase
  KO
K03496  chromosome partitioning protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dia03036]
    Dtpsy_1289
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dia04812]
    Dtpsy_1289
Chromosome and associated proteins [BR:dia03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Dtpsy_1289
Cytoskeleton proteins [BR:dia04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Dtpsy_1289
SSDB
Motif
Pfam: AAA_31 CbiA MipZ ParA ArsA_ATPase CBP_BcsQ VirC1 CLP1_P AAA_33 Fer4_NifH AAA_16 Methyltransf_24 AAA_25 MobB MeaB APS_kinase ABC_tran NACHT
Other DBs
NCBI-ProteinID: ACM32754
UniProt: B9MGT1
Position
1346670..1347308
AA seq 212 aa
MIVALLNQKGGVGKTTLATHIAGELAMRGQHVVLLDADPQGSSLDWTQRRSQQGLPRLFS
AVGLARETLHQEAPELARRADHVIIDGPPRIAALARSALLAAERVLIPVQPSPYDLWASA
EMVALIREAQVFRPALRAAFVINRRVSTTVIGREARQALADQPLPALRAEVHQRIVFADS
VAAGRLARETAPGSAAAREITALVDDLLRWPT
NT seq 639 nt   +upstreamnt  +downstreamnt
atgatcgtcgctttgctcaaccagaaaggcggcgtgggtaagaccacgctcgccacgcac
atcgccggcgagctggcgatgcgcggccagcacgtcgtattgctggacgccgacccgcaa
ggttcatcgctggactggacgcagcgcagaagtcagcaaggcttgccacggctgttcagc
gccgtgggccttgcacgcgaaacgttgcaccaagaggcaccagaactcgccaggcgagca
gatcacgtcatcatcgacggcccgccgcgcatcgccgccttggcgcgctccgcgctgctg
gcggccgagcgcgtgctgatcccggtgcaacccagcccctacgacctatgggccagcgcc
gagatggtggcgctgatccgcgaggctcaggtgtttcggcctgcactgcgcgcggccttc
gtcatcaatcggcgcgtcagtaccaccgtgatcgggcgcgaagcgcgccaggcgctcgcc
gaccagccgcttcctgcgctgcgcgcggaagtgcatcagcgcattgttttcgccgacagc
gtggccgctggccgacttgcacgcgagacggcgccgggcagcgctgccgcacgcgaaatc
accgccctggtggacgacctgctgcggtggccgacatga

DBGET integrated database retrieval system