KEGG   Acidovorax ebreus: Dtpsy_1291
Entry
Dtpsy_1291        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF2840
Other DBs
NCBI-ProteinID: ACM32756
UniProt: B9MGT3
Position
1347565..1348110
AA seq 181 aa
MNASALPAAHAATAAPLRAPSVLAGLVGSVPLTRVSLAYIEPRFKLYLRFGEPARTLQLD
RWRRCAVFLPNAVFCRIRWQANDYGTIRWQLMVMQAATPLDAVQRIPGVQPGARLMLHAE
GENAVRAVLERIDGIDAQGIAAIDVSPAYWRTLGNRLAARLPLPEYTTERHAAWLAGRAL
P
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaacgcatccgctctacctgcggcgcacgcggccacggctgcgccgttgcgcgcgcct
tcggtactcgctggcctcgtcggcagcgtgccgctgacgcgcgtttcgctggcctacatc
gaaccgcgtttcaagctctacctgcgcttcggcgaaccggcgcgcacgcttcagctcgac
cgctggcggcgctgcgcggtgttcctgccgaacgcggttttctgccgcatccgctggcag
gccaacgactacggcacgatccgctggcagctcatggtgatgcaggctgccacgccgctg
gacgccgtgcagcgcatccccggcgtgcagcccggcgcgcgcctgatgctgcacgccgaa
ggcgagaacgcggtgcgtgccgtgctggaacgcatcgacggcatcgacgcgcagggcatt
gccgccatcgacgtgtcacccgcgtactggcgcactctgggcaaccgtctggcggcccgt
ctgccgctgcccgaatacaccaccgagcggcacgccgcttggctggccgggagggcgctg
ccatga

DBGET integrated database retrieval system