KEGG   Acidovorax ebreus: Dtpsy_1292
Entry
Dtpsy_1292        CDS       T00853                                 

Definition
(GenBank) TraF peptidase. Serine peptidase. MEROPS family S26C
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ACM32757
UniProt: B9MGT4
Position
1348107..1348706
AA seq 199 aa
MTAHSTTARTPEAAPRPRSRLRARIVLAGLSACGLAALAWASFVHPLPRLIYNPSDSVAV
GWYRVDPLGHDTGSLPRPLSVGSIVLTTLPPDAATLAAQRGYLPARVPLLKRVGAVAPQE
VCITGRVVRIDGVPSAAVLPADRWGRPLPSWQQCRRLEPAELFLLSVTNPASFDSRYFGP
VSTYAVIGVAHPVWLGSRP
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaccgctcactccaccaccgcgcgcacgcccgaagccgcgccgcgtcctcgctcgcgc
ctgcgtgctcgcatcgtgctggcgggcctgtccgcctgcggcctggctgcgctggcctgg
gcgtccttcgtgcatccgctgccgcgcctgatctacaacccgtccgacagtgtggcggtc
ggctggtatcgcgtcgatccgctgggccacgataccggctcgctgccacgtcctctgtcc
gtgggcagcatcgttctgaccacgctgccgccagacgctgccacgctggccgcgcagcgc
ggctacctgccggcgcgcgtgccgctgctcaagcgcgtgggcgccgttgcaccgcaggag
gtgtgcatcactggccgcgttgtccgcatcgacggcgtgccttcggccgccgtgctgcct
gctgaccgctggggccggccgctgccatcctggcagcaatgccgccgcctcgaacccgcc
gaactgttcctcttgagtgtgaccaacccggcgtcgttcgacagccggtatttcgggccg
gtcagcacatacgccgtgatcggcgtcgcacatccggtctggctgggatcccgcccatga

DBGET integrated database retrieval system