KEGG   Acidovorax ebreus: Dtpsy_1293
Entry
Dtpsy_1293        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF3363 Relaxase MobL
Other DBs
NCBI-ProteinID: ACM32758
UniProt: B9MGT5
Position
1349155..1351128
AA seq 657 aa
MTDRRDDDFRIRPSAPKNRGQGFVSKVLKQAGKANGGKSSVRRAASARGTGQRPGSRLGR
GHTAARFAGAKLTPMSRRVTIKTLLVNQRQASPQSLAKHLRYIERDGVGRDGEPGQAYGP
QTDAAALDAFKERCTDDRHHFRFILSPEDGAELEDLRTYTRHLMGRMEADLGTGLDWVAV
NHWNTDNPHTHIVVRGRDDTGKDLIIAGDYIAHGFRHRAAELATEWLGPRTELEIQQTLQ
REVEQERWTSLDRTLQREAGEDGRVQIERFNEPRLQRQRLLLIGRLQRLQRLGLADEMQP
GTWAVHADAEKTLRTLGERGDIIRTMQRAMRGEPRELAVFEPGEDGRTVVGRVAAKGLAD
ELRDRGYLVIDGVDGKAHYVALNARHELANYPTGAVVEVKGSADVRAADKNIAAQASDGL
YRTDHHLAIEQGRAKPGRDPQEVIAAHVRRLEALRRAGIVERVAEGLWKVPGDLPEQGRR
YDAQRLGGVAVELKSHLPIERQARVIGATWLDQQLIGGGRGLGDLGFGGDAKQAMQQRAD
FLEEQGLAQRRGQRVILARNLLDTLRTRELAQAAKDIAAETGLQHRTVADGQRVTGIYRR
SVMLASGHYAMLDDGMGFSLVPWKPVIEQRLGQQIAATMRGGVVSWDVVRGRGMSIG
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgaccgaccgtcgcgacgacgatttccgcatccgccccagcgccccgaagaaccggggc
cagggcttcgtctccaaggtgctcaagcaggcgggcaaggccaacggcggcaagtcctcg
gtgcgccgtgcggcatcggcgcgtggcaccggccagcggcccggttcgcgcctcgggcgc
ggccacacggcggcgcgcttcgcgggggcgaagctcacgcctatgtcgcggcgcgtgacc
atcaagacgctgctggtcaaccagcgccaggccagcccgcagtcgctcgccaagcacctg
cgctacatcgagcgcgacggcgtgggccgcgacggcgagccgggtcaagcctacgggccg
cagaccgatgcggccgccctcgatgccttcaaggaacgctgcaccgacgaccgacaccat
ttccgcttcatcctctcgcccgaggatggggccgagctggaagacctgcgcacctacacg
cggcacctcatgggccgcatggaggccgacctgggcacgggcctcgattgggtggccgtc
aatcactggaacacggacaacccgcacacgcacatcgtcgtgcgcgggcgcgacgacacc
ggcaaagacctcatcatcgcgggcgactacatcgcccacggcttccgccatcgggccgcc
gaactggcgaccgaatggctgggaccgcgcactgagctggagatccagcagaccttgcag
cgcgaggtggagcaggagcggtggacgagcctggatcgcaccctgcaacgcgaggccggc
gaggacggccgagtgcagatcgaacgcttcaacgaaccgagattgcaacgccagcgcctg
ctgctgatcggccggctgcaacgcttgcagcgcctgggcctggccgacgagatgcagccg
ggcacctgggccgtccatgccgatgccgagaagaccctgcgcaccctgggcgagcgtggc
gacatcatccgaaccatgcagcgtgccatgcgcggcgagccgcgcgagctggcggtattc
gagccgggtgaagatggccgcacggtcgtcgggcgcgtcgccgcgaaaggactggccgac
gagctgcgcgaccggggctatctggtcatcgacggcgtggacggcaaggcccactacgtc
gcgctgaatgcccgtcatgagctggcgaactatccgaccggcgctgtggtggaggtgaag
ggttcggccgacgtgcgcgcagcagacaagaacatcgccgcgcaggcgagcgatggcctg
taccgcactgaccatcacctggcgattgagcaaggccgggctaagcctggccgcgatccg
caggaagtcatcgcggcccatgtccgtcgactcgaagccctgcgccgggccggtatcgtg
gagcgtgtcgccgaagggctatggaaggtgcccggtgacctgcccgaacagggccgccgc
tatgacgcgcagcgcctgggcggtgtggccgtggagctgaaatcgcacctgcccatcgag
cggcaggcccgcgtgatcggagccacctggctcgaccagcagctgatcggtggtggcagg
gggctgggcgatctgggctttggtggcgacgccaagcaggccatgcagcagcgcgccgac
ttcctcgaagaacagggactggcccagcggcgcgggcagcgcgtgattcttgcccgcaac
ctgctcgacacgttgcgcacccgcgaactggcgcaggctgccaaggacattgccgccgaa
accggcttgcagcatcgcactgtggccgatggccagcgcgtgaccggcatctaccggcgc
agcgtcatgctcgccagtgggcactacgccatgcttgatgacggcatggggttcagcctg
gtgccttggaagccggtgatagagcagcgactggggcagcagatcgcggcgactatgcgc
ggcggcgttgtgtcgtgggatgtggtgcggggacgtgggatgtcgatcggctga

DBGET integrated database retrieval system