KEGG   Acidovorax ebreus: Dtpsy_1294
Entry
Dtpsy_1294        CDS       T00853                                 

Definition
(GenBank) D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: XFP XFP_N
Other DBs
NCBI-ProteinID: ACM32759
UniProt: B9MGT6
Position
complement(1351231..1353603)
AA seq 790 aa
MTTASTLRQRWLTGHGPIVHRDETAARVEALVARLIADGRVADEATAYTLLAAADRLGCV
AMNVVAHMTYARRIDLSGAVLSAEDFKPTPEGHTGGSLNMVLAFVGYLLANALTGSTRGW
IMGQGHCVAAIEAVNALTGDVSPAQRGRYDRSEEGLSRLCADFYSYAIDAQGRPAVPLGS
HAGPNTAGAVSEGGYLGFAELQYIHMPLPGESLVAFLSDGAFEEQRGPDWAPRWWRAQDS
GFAVPVMILNGRRIEQRTQIMQEGGAQWLAEDVRHNGFDPVIVDGRDPAAIAWAIIEAED
ALRAFAADPDRRYPAPLPYVIAETEKGFGFRGADSNAAHNLPLGGNPHTDTAMRGLFNEC
AAALLVAPAELDAALAAFATHAAQQRPLESTHPLAHRHPAAPRLPEPRWEISGSEGSAMT
ALDQWFVEFAKANPELRMRIGNPDELASNKMGDTLALLKHRVNEPEPSVPEDLHGAIITA
LNEEAVAAAALGNKGGLNLIVSYEAFAVKMLGLMRQEITFSRHQRQVGRPAGWLSVPLIV
TSHTWENAKNEQSHQDPTIGEALLGEMSDTSRVLFPVDGNTAVAALRDVYAGRGQLACLI
VSKRDVENRFDAESAQRLIRDGAAHLIGDPAKADVQLIALGAYQLDEAIKAQRHLARLGK
RACVTVILEPGRLRIPRDAMEAEFVDDDATVNALFPPGLPRVILTHTRPEPMLGILRRID
SGPARTRALGYICRGGTFDVPGMLFANRCTCAHAVDAAATVADWNREALLDHAQRAALDG
TGDPRDLLSA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgaccaccgcttccaccctccgccagcgctggctgaccggccacggccccatcgtccat
cgcgacgagaccgccgcacgtgtcgaggcgctggtggctcgcttgatcgctgacggccgc
gttgccgacgaagcaacggcctacaccctgcttgccgccgccgaccgcctgggctgcgtg
gccatgaacgtggtcgcgcacatgacctatgcgcgccgcatcgatctttccggcgcggtg
ctgtcagccgaggacttcaagccaacgcccgaaggccacaccggcggctcactgaacatg
gtgctggccttcgtcggctacctgctcgccaacgcgctcaccggtagcacgcgcggctgg
atcatgggccaaggccattgcgtcgccgccatcgaagccgtcaatgcgctgaccggcgac
gtctcgcccgcgcagcggggtcgctacgaccgcagcgaggaaggcctgtcgcgcctgtgc
gccgatttctattcctacgccatcgatgcgcagggccgcccggcggtgccgctgggcagc
catgccggccccaatactgccggcgccgtgtccgaaggcggctacctcggctttgccgaa
ctgcagtacatccacatgccgctgcctggtgaatcgctggtcgccttcctgagcgacggc
gccttcgaggagcagcgtggcccggactgggcaccacgctggtggcgtgcgcaggacagc
ggcttcgctgtgccggtgatgattctcaacggtcgccgcatcgagcagcgcacccaaatc
atgcaggaagggggtgcgcaatggctggccgaagacgtgcgccacaacggcttcgacccg
gtgatcgtcgatggccgcgacccggctgcgatcgcctgggcgatcatcgaagctgaggac
gcgttgcgcgccttcgccgctgatccggatcgccgctatccggcgcctctgccctacgtg
atcgccgagaccgagaagggcttcggctttcggggcgcagacagcaacgccgcgcacaac
ctgccgctgggcggcaacccccacacggataccgccatgcgtgggctgttcaatgaatgc
gcggcggcactgttagttgctccggccgaactcgatgctgcgctcgccgccttcgcaact
cacgccgcccagcagcgcccgctggaaagcacgcatccgctagcgcaccgccaccccgct
gcgcccaggttgcccgaaccgcgctgggaaatatcaggcagcgaaggcagtgcgatgacg
gcgctggaccagtggttcgtcgaattcgccaaagccaatcccgagctgcgcatgcgcatc
ggcaaccctgacgaattggccagcaacaagatgggcgacacgctggcgctgctcaagcac
cgcgtcaacgagcccgaacccagcgtgcccgaggacctgcacggcgccatcatcaccgcg
ctcaacgaagaagccgtggccgccgccgcgctcggcaacaagggtggactgaacctgatc
gtcagctacgaagcgttcgccgtgaagatgctcggtctgatgcggcaggaaatcaccttc
tcccgccaccagcgccaggtcggccggcccgccggctggctgtctgtgccgctcatcgtc
acctcgcacacctgggaaaacgccaagaacgaacaatcacatcaagatccgaccatcggc
gaggccctgctgggcgagatgtcggacacctcgcgcgtactgttcccggtggatggcaac
accgccgtcgccgcgctgcgcgacgtctatgccggacgcggccaactggcctgcctgatc
gtctccaagcgcgacgtggaaaaccgcttcgacgccgaatcggcgcaacgcctgatccgt
gacggtgcagcccatctgatcggcgaccctgccaaggccgatgtccagctcatcgcgctg
ggcgcctaccagctcgacgaggcgatcaaggcgcagcggcaccttgccagactgggcaag
cgcgcctgcgtcaccgtcatcctggaacccggccgcctgcgcatcccgcgcgacgccatg
gaagccgaattcgtcgatgacgacgccaccgtcaacgcgctgtttccgccgggcctgccg
cgcgtgatcctcacccacacccgccccgagcccatgctcggcatcctgcgccgcatcgac
agcggccccgccagaacccgcgccctcggctacatctgccgcggcggtactttcgatgtc
cccggcatgttgttcgccaaccgctgcacctgcgcgcatgcggtggatgcagcagcgacc
gtggccgactggaatcgcgaagcactgctcgaccatgcacagcgcgcagctcttgatggc
accggcgatccacgtgatttactgagcgcgtga

DBGET integrated database retrieval system