KEGG   Acidovorax ebreus: Dtpsy_1295
Entry
Dtpsy_1295        CDS       T00853                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
dia  Acidovorax ebreus
Pathway
dia00430  Taurine and hypotaurine metabolism
dia00620  Pyruvate metabolism
dia00640  Propanoate metabolism
dia00680  Methane metabolism
dia01100  Metabolic pathways
dia01120  Microbial metabolism in diverse environments
dia01200  Carbon metabolism
Module
dia_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtpsy_1295
   00640 Propanoate metabolism
    Dtpsy_1295
  09102 Energy metabolism
   00680 Methane metabolism
    Dtpsy_1295
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Dtpsy_1295
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Dtpsy_1295
SSDB
Motif
Pfam: Acetate_kinase
Other DBs
NCBI-ProteinID: ACM32760
UniProt: B9MGT7
Position
complement(1353686..1354894)
AA seq 402 aa
MSNSQPSLILVLNCGSSSIKFALFDAQARPLPRKPFWHGKVQGITGPVPEYSDSGTAQQR
IHLDHEHPHTAALALIQARIVARLDGRRIVAIAHRVVHGGSRYFEPTLVTAGTIAELRAL
IPLAPLHQPFPLKAMSLLFEQWPGIVQVACFDTAFHRTEPKVEQILPLPYSAWERGLRRY
GFHGLSYDYMSHVLPERHGDLARGRTIVAHLGSGASLCAMQNLQSVATTMGFSALDGLMM
GTRTGSLDPGALLYLMEIEKLSLEEVGRTLYNQSGLLGVSGISAEPRVVVMHEADPGEAG
ERARIALALYVRRIVREIGALVAVLGGLDLFVFTAGVGEHNAFVRERVCRDLAFLDIKLD
TDANAIDAPVISTTDSRVLVAVEPTNEEWVAARYTQELMSAA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgagcaactcacagccgagcctcatcctggtactcaattgcggctcctcaagcatcaag
ttcgccttgttcgatgcacaggcgcgcccgttgccgcgcaagccgttctggcacggcaag
gtgcaagggattactgggcctgtgcctgagtacagcgacagtggcactgcacagcagcgc
atccatttggatcacgaacaccctcacaccgccgctctggcgttgattcaagcgcgcatc
gtggcccgactcgatggccgccgcattgtggccatcgcgcatcgtgtcgttcatggcggc
agcaggtacttcgagccaaccctggtgaccgctggcaccatcgcggagctgcgggccttg
attcctttggcgcccctgcaccaaccctttcctctgaaggccatgagtttgctgttcgag
cagtggcccggaattgttcaggtagcgtgcttcgatacagcctttcaccgcacggagcca
aaggtggagcagatcctgccgctgccgtactcggcctgggaacgcggtctgcgccgttac
ggcttccacggcctttcgtacgactacatgagccacgttctccccgagcgccacggcgat
ctggcacgcggccgcaccatcgtcgcgcatctcggcagcggggccagcctgtgcgcgatg
cagaacctgcaaagcgtcgccaccacgatgggcttttccgcactcgacggcctgatgatg
ggcacccgcacaggttcgctcgatccgggcgccttactctacctgatggaaatcgaaaag
ctctcgctggaagaagtgggccgcacgctttacaaccagtccggcctgctcggtgtttcc
ggaatttcggccgaaccgcgcgtcgtggtgatgcacgaggctgatcctggcgaagccggc
gaacgcgcccgcatcgcgttagcgctctacgtgcgccgcatcgtgcgcgagattggcgcg
ctggtcgcagtccttggcggcctggatctgttcgtgttcactgccggcgtcggtgagcac
aacgccttcgtgcgcgagcgcgtctgccgcgacctggcctttctcgacatcaaactggat
acggatgccaacgccattgatgccccagtcatctccaccaccgacagccgggtactggtc
gcggtggagcctaccaacgaggaatgggtcgcagcacgctatacgcaggaattgatgagc
gccgcgtga

DBGET integrated database retrieval system