KEGG   Acidovorax ebreus: Dtpsy_1298
Entry
Dtpsy_1298        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Lysine_decarbox LDcluster4 DNA_processg_A Toxin_8
Other DBs
NCBI-ProteinID: ACM32763
UniProt: B9MGU0
Position
complement(1356667..1357533)
AA seq 288 aa
MTPSADPDERLRAILDSPTYRLAYEDIDLLGQEELRPLRLQLELLKPERILHEQGVHSTV
VVFGSARVSDAETATARLDALEQQARTTPQNSKLTQELSRARRRVEQARYYEEAQRFAHL
ISKRFQQQERCDFVVITGGGPGIMEAANRGAFDAGARSIGLNITLPHEQTPNSYMCPELA
FRFHYFALRKMHFLMHARGLVTFPGGFGTLDELFEVLTLIQTGKMQRIPVVLVGRTFWHR
AVDFDLLLDEGYVSPSDLDLFTCVDKAEEIIGALERFYIDRATDGTPS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaccccatccgctgatcctgacgagcgcctgcgcgccatcctcgattcacccacgtac
cgtcttgcgtacgaagacatcgatttgcttggccaggaagagcttcggccattgcgcctg
cagcttgagctgctcaagcccgagcgcatcctgcacgaacaaggcgtccattcgacggtg
gtggtcttcggcagtgcacgcgtcagcgacgccgagacggccaccgcccgccttgacgcg
ctggagcagcaggcgcgcaccacgccgcagaattccaagctgacacaagagctctcccga
gcccgccgccgcgtggaacaggcgcgctactacgaagaggcacagcgcttcgcccacctg
atttccaagcgcttccagcaacaggagcggtgcgatttcgtcgtcatcaccggtggcggg
ccaggcatcatggaggcagccaatcgcggtgctttcgatgccggggctcgctcgatcggg
ctcaacatcacgttgccgcacgaacaaaccccgaactcctacatgtgtccggagctggcg
ttccggttccactatttcgcgctgcgcaagatgcatttcctgatgcatgcgcgtggtctg
gtgacctttccgggcggcttcggcacgctcgatgaattattcgaagtgttgactttgatc
caaaccggcaagatgcagcggattccggtggttctggtcggtcgcaccttctggcatcgg
gccgttgatttcgaccttctgctcgacgaaggctacgtatcaccatccgatctcgacttg
tttacctgcgtggacaaagccgaagaaatcattggcgccctggaacgcttttacatcgat
agggcaacagacggcacgccatcatga

DBGET integrated database retrieval system