KEGG   Acidovorax ebreus: Dtpsy_1299
Entry
Dtpsy_1299        CDS       T00853                                 

Definition
(GenBank) beta-lactamase domain protein
  KO
K07576  metallo-beta-lactamase family protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    Dtpsy_1299
SSDB
Motif
Pfam: Beta-Casp RMMBL Lactamase_B Lactamase_B_2 Lactamase_B_6 Lactamase_B_3
Other DBs
NCBI-ProteinID: ACM32764
UniProt: B9MGU1
Position
complement(1357530..1358942)
AA seq 470 aa
MKLNFLGAAREVTGSCFLVEALNLRFLVDCGMVQGGRTAAARNREPFTFDPASIDFVLLT
HAHIDHSGLLPKLTRAGFKGAIYATPATVDLLGVMLPDSAHIQESDAKRSAKRSRGEDAL
PPLYTLQDARECLQQVRGIEYDREFAPRVGVRARFRDAGHILGSAIIEVWVTEYGYPTKL
VFSGDLGQPGRPILRDPTPIEDADILVIESTYGNRQHKDLSATEEEMIGIVEKTLFERGG
NVIVPAFAVGRTQEVLYHLHRLTSEGRLRQPKVFVDSPMATEATRITREHLELFDEQAKR
LAGWHARGENLPYLHFTESAEESMTLNQIRSGAIIISASGMCDAGRIRHHLRHNLPRKEC
SVLFSGFQAQGTLGRQLVDGAQRVRIFGDDIPVRAAIHSVDGLSAHADQPALMAWARGFK
QAPEQTFVVHGEPSAAQNFAELLQQQLGWQVSVPEHGQVVPWPDFLAIER
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaaactgaactttctgggcgctgcgcgtgaagtcaccggatcgtgcttcctggtggag
gcgctcaacctgcgcttcctggtggattgcggcatggttcagggcgggcgcacggcggcg
gcgcgcaatcgcgagccgttcacgttcgatccggcgtcgatcgacttcgtgctcctgacc
catgcccatatcgaccatagcgggctgttgcccaaactcacgcgcgctgggttcaaagga
gccatctacgccactcccgctacggttgatctgctgggcgtgatgctgcccgatagcgca
cacatccaggagagcgatgcaaaacgcagtgccaaaagatcccgtggagaggatgcgctg
ccgccgctgtacacgctgcaggatgcgcgcgaatgcctgcaacaagtacgaggcatcgaa
tacgaccgggagttcgcgccccgtgtcggggtgcgcgcacgctttcgcgatgccggacac
atcctcggatcggccattatcgaagtctgggtcaccgagtatggctacccgacgaaactg
gtattcagtggcgaccttggccagccgggacgcccgatattgcgcgacccgacacccatc
gaggacgccgacatcctcgtcatcgagtccacctatggcaaccgccagcacaaggacctc
tcggccaccgaagaggagatgatcggcatcgtcgagaaaaccctgttcgagcgcggtggc
aacgtcatcgtgccggccttcgcggtcggtcgaacccaggaagtcctctaccacctgcac
cgtctcaccagcgaggggcgactgcggcaaccgaaggtattcgttgattcgcctatggcc
acggaagccacgcgcatcacacgcgagcaccttgagctgttcgatgagcaggcaaagcgc
ctggcaggatggcacgcgcgcggcgaaaacctgccgtatctgcatttcacggaaagtgcc
gaagagtccatgacgctgaaccagattcgttcgggcgccatcatcatttccgccagcggc
atgtgcgatgcggggcgcatccggcaccacctgcgccacaatttgccgcgcaaggaatgc
agtgtcctgttctccggcttccaggcgcagggaacacttggccgtcaactggtcgatggc
gctcaacgcgtgcgcatcttcggcgacgacattccggtgcgcgcggcgatccacagtgtc
gatgggctctcggcgcacgccgaccaaccggccctgatggcctgggcccgcggcttcaag
caagccccggagcaaaccttcgtggtgcatggggagccgtccgctgcgcagaattttgcg
gaactcctgcaacagcagcttggctggcaggtctcggtgcctgaacatggccaggtggtg
ccctggccggattttctggcgatcgagcgatga

DBGET integrated database retrieval system