KEGG   Acidovorax ebreus: Dtpsy_1300
Entry
Dtpsy_1300        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF2892
Other DBs
NCBI-ProteinID: ACM32765
UniProt: B9MGU2
Position
complement(1358959..1359159)
AA seq 66 aa
MQINVGNLDRIARVVIGLILLSLPLWLDSPWRWLGLIGIMPLITGLAGRCLGYRLLGVST
CPMQKK
NT seq 201 nt   +upstreamnt  +downstreamnt
atgcaaatcaacgtaggaaatctcgaccgcatcgcgcgcgtcgtcatcggcctgatcctg
ctcagcttgccgttgtggctggattcaccgtggcgctggctggggctcattggaatcatg
ccgttgatcaccggcctggcgggtcgctgcctaggttaccgcctgctcggcgtgagcacc
tgcccgatgcaaaagaaataa

DBGET integrated database retrieval system