KEGG   Acidovorax ebreus: Dtpsy_1304
Entry
Dtpsy_1304        CDS       T00853                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dia02000]
    Dtpsy_1304
Transporters [BR:dia02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Dtpsy_1304
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 AAA_27 KdpD SRP54 AAA_16 AAA_22 Rad17 RsgA_GTPase TsaE AAA_30 RNA_helicase AAA_18 AAA_15 Ploopntkinase3 Cdc6_C
Other DBs
NCBI-ProteinID: ACM32769
UniProt: B9MGU6
Position
complement(1363010..1364782)
AA seq 590 aa
MQADTAMAATPASAVAAAAVVIEGVDKHFGKVQALRSLSAHIHYGRLTGLVGPDGAGKTT
LMRILTGLLVPNAGRVTLAGFDVVKDNDAIHVASGYMPQRFGLYEDLSVMENMRLYAQLR
GMDADRNADLFAELLDFTRLGPFTKRLAGKLSGGMKQKLGLACALMARPKVLLLDEPGVG
VDPVSRQDLWRMVQALTDEGMAVVWSTAYLDEAERCESVLLLNQGQLLFDGPPQQLTAQL
EGRSFRLENVGAERRAVLTEALDLESVSDGVIQGAGVRVVLRDGAQASQIQSLADRARVA
LAPVPARFEDAFIDLLGGGPGGTSTLAERLPPVELGSDVAVSCRNLTKRFGEFTATDNVS
FEVQKGEIFGLLGPNGAGKSTTFKMLCGLLKPTAGEAHVVGHDLRRATGAAKGRLGYMAQ
KFSLYGLLSVQQNLEFSAGVYGLEGNTRRERIAEMIETFDLGEWLSATPDSLPLGHKQRL
ALACSLMHRPPVLFLDEPTSGVDPITRREFWTHINGLARKGVTIMVTTHFMDEAEYCDRV
AMLSRARLIALDTPDALKRAAANVEHPDPTMEDAFIHLVESADREMEAAA
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcaggcagacaccgccatggccgccacgccggcaagcgctgtcgccgctgccgccgtc
gtcatcgaaggggtggacaagcatttcggcaaggtgcaggccctgcgcagcttgagcgcg
cacatccactacggacggctgacgggcctggtcggcccggacggcgccggcaagacgacg
ctgatgcgcattctgaccggcctgctggtgcccaacgccggtcgcgtcaccctggctggc
tttgacgtggtcaaggacaacgacgccatccatgtcgccagcggttatatgccgcagcgc
ttcggcctgtacgaagacctgtcggtgatggagaacatgcgcctgtatgcgcagctgcgc
ggcatggacgcggatcgcaatgccgatctgtttgccgagttgctggacttcacgcggctt
gggccctttaccaaacgcttggccggcaagctctccggcggcatgaagcaaaagttgggg
ctggcctgtgcgctgatggcgcggcccaaggtgctgctgctggacgagcccggcgtgggc
gtcgatccggtcagccggcaggatttgtggcgcatggtgcaggcactgaccgatgagggc
atggccgtggtctggtccaccgcctacctcgacgaggccgagcgctgcgagagcgtgctg
ctgttgaaccaggggcagctcctgttcgatggtccaccgcagcaactcaccgcgcaactt
gaaggccgcagctttcgcctggaaaacgtcggcgccgagcgccgcgcggttctgaccgag
gcactcgatctggagagcgtgagcgacggagtgatccagggcgccggcgtgcgtgtggta
ctgcgggacggtgcgcaggcaagccaaatccagtcgctggctgatcgtgcgcgcgtagcg
ctggccccggtgcccgcacgcttcgaagacgctttcatcgatttgcttggcggcggcccc
ggcggtacttcgacactggccgagcgcctgccaccagtcgagctgggttcggacgttgcc
gtgtcctgccgcaacctcacgaaacgcttcggcgaattcaccgccaccgacaacgtcagc
ttcgaggtgcaaaagggcgaaatcttcggtctgctcggccccaatggcgccggcaagtcc
accaccttcaagatgctgtgcggcctgttgaaacccactgctggtgaagcgcatgtggtg
ggccatgatctgcgccgcgccaccggtgcagccaagggccggctcggctacatggcgcag
aaattctcgctctacggtctgctgtcggtgcagcagaacctggaattttcggccggcgtt
tacgggctggaaggcaacacccggcgcgagcgcattgccgagatgatcgagaccttcgat
ctgggggagtggctgtccgccacgcccgattccctgccgctggggcacaagcagcgcctg
gcgctggcctgctcgctcatgcatcggccacccgtgctgttcctcgatgagcctacttcg
ggcgtggacccgatcacccggcgcgagttctggacccacatcaacggcctggcgcgcaag
ggcgtgaccatcatggtcaccacccacttcatggacgaggccgaatactgcgaccgcgtc
gccatgctctcgcgcgcacgcctgatcgcgttggacacgcccgatgcgctcaagcgcgcc
gcagccaatgtcgaacaccccgacccgaccatggaggacgccttcattcacctggtggaa
tctgccgaccgcgagatggaggccgccgcatga

DBGET integrated database retrieval system