KEGG   Acidovorax ebreus: Dtpsy_1305
Entry
Dtpsy_1305        CDS       T00853                                 

Definition
(GenBank) secretion protein HlyD family protein
  KO
K01993  HlyD family secretion protein
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Dtpsy_1305
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 DUF1090
Other DBs
NCBI-ProteinID: ACM32770
UniProt: B9MGU7
Position
complement(1364784..1365824)
AA seq 346 aa
MTTPNLPTRKARWAVIIVALLALGGALAFWFTRGHDNQDALRLYGNVDIREVQLAFRQPG
RITQMTFDEGDVVTAGARLATLDAQPYQDALAAAQAQVQVAQAELAKLRRGLRPQEITQA
REALRQAQAQALDAERNFQRQSSLLASGASSQRTVDAARTARDQAAAGVESAKAALSQAS
EGFRKEDIEAAQARLAAAQAAAAQATTSLADTELTAPSNGTIIARVREPGSMVASQSTVY
SLSLDKPVYVRAYVGERDLGRIAPGTVVHVRSDSGEKVYRGQVGFISPRAEFTPKTVETT
DLRTDLVYRLRIVIDEADSDAALRQGMPVTIAVDAKPVSGARAGER
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgacaactccgaacctccctacaagaaaagcccgttgggccgtgatcattgttgccctg
ctcgcccttggcggtgcactggcgttctggttcacgcgcggccatgacaaccaggatgca
ttgcgcctctatggcaacgtcgacatccgcgaggttcaactggctttccgccagcccggg
cgcatcacgcaaatgactttcgatgagggtgatgtcgtcaccgccggcgcgcgcctggcc
acgctcgacgcgcagccatatcaagacgcccttgcagccgcgcaagcccaggtgcaggtg
gcccaggccgagctggccaagctgcgccgcggcctgcggccgcaggaaatcacccaggca
cgcgaggcgctcagacaagcgcaggcgcaggcgcttgacgccgagcgcaacttccagcgc
cagagcagcctgttggcgtcgggcgccagcagccagcgcacggtcgatgccgcacgcact
gccagggatcaggcggccgcgggtgtcgaatccgccaaggccgccctgtcgcaggcatcc
gaaggctttcgcaaggaagacattgaggcagcgcaggctcgccttgcagccgcgcaggca
gccgcggcgcaagccaccacttccctggcggacaccgaactgacggcacccagcaacggc
accatcatcgcgcgggtgcgcgagcccggcagcatggtggccagccagagcacggtctac
agcctgagtctggacaagcccgtgtacgtgcgcgcctacgtgggcgaacgggatctgggc
cgcatcgcaccgggcaccgtggtgcacgtcaggagcgattccggggaaaaggtctatcgc
ggccaggtcggcttcatctcgccgcgcgccgagttcacgccaaagacggtggagacaacg
gacttgcgcacggatctggtgtaccgcctgcgcatcgtcatcgacgaggccgacagcgat
gccgccctgcgccagggcatgccggtgacgatcgcggtcgatgccaagccggtctccggc
gcgcgcgcgggggagcgttga

DBGET integrated database retrieval system