KEGG   Acidovorax ebreus: Dtpsy_1306
Entry
Dtpsy_1306        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: NdhL DUF3397
Other DBs
NCBI-ProteinID: ACM32771
UniProt: B9MGU8
Position
complement(1365852..1366271)
AA seq 139 aa
MTAHSGRGIWMRVIALIAIAFGLLTIREGGAVLFFDGAARAAAGSYVPFVLWFNFLAGFA
YVIAGAGLWMRRRWAAWMSMAIAVATALVFLAFGVHVALDGAWERRTLIAMTLRTLVWVG
IAAMAWRRSTAHAPTTREH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgactgcacacagcgggcgcggaatctggatgcgtgtgatcgccctgattgccatcgca
tttggtctgctgaccatcagggaaggcggcgccgttctgttttttgacggcgcggcgcgt
gccgcagccggaagctacgtgccgttcgtgctctggttcaacttcctggccgggtttgcc
tacgtcatcgctggcgccggattgtggatgcgccggcgctgggccgcatggatgtcgatg
gctatcgcggtggcaacggcgctcgtattcctggccttcggagtgcatgtggcgctggac
ggcgcttgggagcggcgcacgctcattgccatgacgctgcgtacgttggtgtgggttggc
attgcggccatggcttggcgtcgatcaacagcgcatgcaccgaccacgcgcgagcactga

DBGET integrated database retrieval system