KEGG   Acidovorax ebreus: Dtpsy_1307
Entry
Dtpsy_1307        CDS       T00853                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: TetR_N TetR_C_24 TetR_C_7 TetR_C_4 TetR_C_11 TetR_C_2 TetR_C_29 TetR_C_6 TetR_C_15 TetR_C_17 TetR_C_13 Peptidase_C1_2 TetR_C_9
Other DBs
NCBI-ProteinID: ACM32772
UniProt: B9MGU9
Position
complement(1366340..1366948)
AA seq 202 aa
MSQRPQYLSAEDRRAATVQAVVDLAAEQNPAEITTTAIADRMGLTQGALFRHFPTKEAIV
EATMSWVGERLLVSVDKAAEGAASPAAALEAMFITHIDFVSKHPGVPRMLFGELQRSGET
LAKRMVQTLIRQYEQRLRRLMEAGKAQGELSAELDVDAAAVLFIGTIQGLVMQSLLAGKV
SRIRRDAPAVFAIYRRGIESGT
NT seq 609 nt   +upstreamnt  +downstreamnt
gtgagtcaacgcccccaatacctgtccgccgaagatcggcgtgcggccacagtgcaagcc
gtggttgatctggcagccgagcagaacccggccgagatcacgaccacggcgattgccgac
cgaatgggcctgacacagggcgcgctgtttcgccacttccccaccaaggaagccatcgtg
gaagccacgatgtcgtgggtcggcgaacgtcttctggtcagcgtggacaaggcggccgag
ggcgccgcatctcccgccgcagcgctcgaagcgatgttcatcacgcacatcgacttcgtg
tccaagcacccgggcgtgccacgcatgttgttcggagagttgcagcgctctggcgaaacg
ctcgccaagcgcatggtgcaaaccctgatccgccagtacgagcagcgcctgcgtcgcctg
atggaagcgggcaaggcgcagggcgagctgagcgcggagctggacgtggacgccgccgcc
gtgctgttcatcggcacgatccagggactggttatgcagtccttgctggccggcaaggtc
agccggattcgtcgcgatgcgcccgccgtgttcgccatctatcgccgtggcatcgaaagc
ggcacatga

DBGET integrated database retrieval system