KEGG   Acidovorax ebreus: Dtpsy_1308
Entry
Dtpsy_1308        CDS       T00853                                 

Definition
(GenBank) Poly-beta-hydroxybutyrate polymerase domain protein
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
dia  Acidovorax ebreus
Pathway
dia00650  Butanoate metabolism
dia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dtpsy_1308
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Dtpsy_1308
SSDB
Motif
Pfam: PhaC_N PHBC_N Abhydrolase_1 Rad50_zn_hook DLH
Other DBs
NCBI-ProteinID: ACM32773
UniProt: B9MGV0
Position
1367270..1369027
AA seq 585 aa
MSNVATHGKADLAQPEACRPDTLDTLANAWRARSTGGLSPAAGLLAWYDWALHLSLSPGK
QRSLIEKGLHKQQRLARYALRVASAHDCPTCIEPLEQDRRFAAPAWQQWPFNVIHQGFLL
QQQWWHNATTGVRGVSRHHENMVTFAGRQWLDMWSPSNFIWTNPEVLHAITQSGGANLWR
GAMNFLEDARRLALDDAPAGVEGFEVGKDVAVTPGKVVFRNHLIELIQYSPTTPDVHAEP
VLIVPSWIMKYYILDLSPHNSMVKYLVDQGHTVFILSWKNPTAADRDLGLEDYRWLGVMD
ALDAVTAIVPERKVQAVGYCLGGTLLAIAAAAMARDGDERLQSLTLLASETDFRESGEIA
LFIDDSQLAWLEAGMWDKGYLDGKQMAGAFQMLNSRDLIWSRRVREYLLGERQTFNDLMA
WNADVTRMPYRMHSEYLRRLYLDNDLAEGRYRVGGRPVALADIEVPMFIVGTVRDHVAPW
PSVYKMHLLSDAELTFVLTSGGHNAGVVSEPGHPRRSFQIATRAAGDRYIDPQLWRAETP
MNEGSWWPAWQQWLAQRSAGRVAPPAMGGTQAPLGDAPGTYVAMR
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgagcaacgtcgcaacacacggcaaggccgatctggcgcagcccgaagcctgtcgccct
gacaccctggatacgcttgcgaacgcctggcgggcgcgcagcacgggtgggctgtcaccg
gcggccggcctgctggcctggtacgactgggcgttgcacctgagcctttcaccaggcaag
caacgcagcttgatcgaaaagggtttgcacaagcagcagcgccttgcgcgctatgccttg
cgcgttgccagtgcgcacgactgcccgacctgcatcgaaccgctggagcaggatcggcgc
tttgccgccccggcttggcagcagtggcccttcaacgtgattcaccagggctttttgctg
cagcagcagtggtggcacaacgccaccacgggcgtgcgtggcgtgtcgcgccatcacgag
aacatggtcactttcgccgggcggcagtggctggacatgtggtcgccttcgaatttcatc
tggaccaaccccgaggtgctgcacgccatcacgcaaagcgggggcgcaaacctgtggcgc
ggcgccatgaactttctggaagatgcaaggcgcctcgcgctcgacgatgcgcctgcaggg
gtcgaagggttcgaggtcggcaaggacgtggcggtcaccccaggcaaggtggtgtttcga
aaccacctgatcgagttgatccagtactcacccacgacgccggatgtgcatgcggagccg
gtactgatcgtgccgtcctggatcatgaagtactacatcctcgacctgtcgccgcacaac
tcgatggtgaagtacctggtcgatcaggggcacacggtgttcatcctttcatggaagaac
ccgacggcggccgatcgtgacctcggcctggaggactaccgctggctgggggtcatggac
gcattggatgcggtcacggccatcgtgcccgaacgcaaggtgcaggcggtcggctattgc
ctgggcggcaccttgctcgcgatcgccgccgccgcgatggcgcgcgatggcgacgagcgt
ctgcaaagcctgacgctgctggcatcggagactgatttccgcgagtcgggcgagatcgcg
cttttcatcgacgacagtcaactggcatggctggaagccggcatgtgggacaagggctat
ctcgacggcaagcagatggctggcgcgttccagatgctcaactcacgcgacctgatctgg
tcgcgacgggtgcgcgaatacctgttgggtgagcgtcagaccttcaatgacctgatggcc
tggaatgccgacgtgacccgcatgccgtaccgcatgcacagcgagtacctgcggcgcctg
tatctggacaacgacctggccgaggggcgctaccgcgtcggcgggagacccgtggcgctg
gccgacatcgaggtgcccatgttcatcgtcggcacggtgcgcgatcacgtcgccccctgg
ccgtccgtgtacaagatgcacctgctcagcgatgcggaactgacctttgttctcaccagc
ggggggcacaacgccggcgtcgtcagcgagccgggacacccccggcgcagcttccagatt
gcgacccgtgcggccggcgatcgctatatcgatccgcaactgtggcgtgccgagaccccg
atgaacgaaggctcctggtggccggcatggcagcaatggctggcccagcgctctgccggg
cgcgtcgcgccgcctgccatgggcgggacgcaagcaccgcttggcgatgcgccgggaacc
tatgtggccatgcgatga

DBGET integrated database retrieval system