KEGG   Acidovorax ebreus: Dtpsy_1309
Entry
Dtpsy_1309        CDS       T00853                                 

Definition
(GenBank) hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Phasin_2 TetR FA_desaturase_2
Other DBs
NCBI-ProteinID: ACM32774
UniProt: B9MGV1
Position
1369135..1369578
AA seq 147 aa
MNSELPIQLYKANAELQLQITRLLQESGHHWLEAMQQLSAGGVLETTSRIQNLQQAADWQ
ALATLPSEVFWRLCQGRMGDTQAVGRAAAKSQAAFADGLREALTTWQASVSEVFGASGGT
ASFAQFFQQWTQPWTAPGAAPQGKAKK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaacagcgaactgcccatccaactctacaaggccaatgccgagttgcagcttcagatc
acccgcttgcttcaagaaagcggccaccactggctcgaagccatgcagcagctcagtgcc
ggtggcgtgctggagaccacctcgcgcatccagaacctccaacaggcagcggactggcag
gcgcttgccaccttgccgtccgaggtgttctggcgcctgtgccaaggccgtatgggcgac
acacaggcggtcggccgggctgctgccaagagccaggcggcattcgccgatggcctgcgc
gaagcgctgaccacctggcaggcatctgtctccgaggtattcggcgccagcggcggcaca
gcctctttcgcgcagttttttcagcaatggacgcagccctggactgcgccaggcgccgcg
cctcagggcaaggccaaaaagtga

DBGET integrated database retrieval system