KEGG   Acidovorax ebreus: Dtpsy_1311
Entry
Dtpsy_1311        CDS       T00853                                 

Definition
(GenBank) UspA domain protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Usp SRP54
Other DBs
NCBI-ProteinID: ACM32776
UniProt: B9MGV3
Position
1370404..1370967
AA seq 187 aa
MYSRFLVPLDGSPTSFLALDHAAELARLSGATVILLHIVEPTRHSTGFERPEVYIKDVRP
RFLEAGQALLDEAASRLRRNGIATETVLLESGTARVSEQIAQQAEVSDCDLVILGTHGRR
GMNRLLLGSDAEQVARIAPVPVMLVRQSSRDGDQTRSAARTPVEASDNAGTQRRHPTRAN
KLKKPHE
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtattcccgatttctggtgccgctggacggcagtcccacatccttcctggcgctcgat
catgcggcagaactggcacgcctgagcggcgccaccgtgatcttgctgcatatcgtcgaa
ccaacccgccacagcacgggtttcgaacgtcccgaggtctacatcaaggatgtccgccca
cgcttcctcgaagccggccaggcgttgctggatgaagctgcgagtcggcttcgtcggaac
ggaattgccacagagacggtgctgcttgagagcggcaccgcacgcgtgtcggaacagatc
gcacagcaggccgaggtgagcgattgcgacttggtcatcctgggcacccatgggcgtcgc
ggcatgaaccggctgctgctgggcagcgatgcagagcaagtggcgcgcatcgcaccagtt
ccggtaatgctggtgcgccagtcgagccgagatggtgaccagacacgctcagccgcacgg
acgccagtcgaggccagcgacaacgccggtacgcaacgccggcatccaactcgcgcaaac
aagctaaaaaaaccacatgaatga

DBGET integrated database retrieval system