KEGG   Acidovorax ebreus: Dtpsy_1312
Entry
Dtpsy_1312        CDS       T00853                                 

Definition
(GenBank) Phosphate butyryltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
dia  Acidovorax ebreus
Pathway
dia00430  Taurine and hypotaurine metabolism
dia00620  Pyruvate metabolism
dia00640  Propanoate metabolism
dia00680  Methane metabolism
dia01100  Metabolic pathways
dia01120  Microbial metabolism in diverse environments
dia01200  Carbon metabolism
Module
dia_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtpsy_1312
   00640 Propanoate metabolism
    Dtpsy_1312
  09102 Energy metabolism
   00680 Methane metabolism
    Dtpsy_1312
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Dtpsy_1312
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Dtpsy_1312
SSDB
Motif
Pfam: PTA_PTB EIIA-man
Other DBs
NCBI-ProteinID: ACM32777
UniProt: B9MGV4
Position
1370960..1371913
AA seq 317 aa
MNEQAPEGVRADPPSGVERLIAHVKTLAPVRTAVVHPCDALSLGGALDARDAGVITPVLV
APLAKLRAVATDTGLELGDSEVVDVPHSHAAAAIAARLAGKGEVQALMKGSLHSDEYLGA
ILAPEACLRTERRLTHCYIMQTASYPRPFIITDAAINIAPTLEIKADIVRNAIDLAHAIG
IAEPKVAILAAVETVNPRMLSTLDAAALCKMADRGQITGGVLDGPLAFDNAVSSDAARVK
GIKSTVAGQADILVVPDLESGNMLAKQLEYMGQADSAGIVMGARVPIVLTSRSDSRRTRI
ASCAIALILAHSQRALV
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaatgaacaagcccctgagggcgttcgcgccgatcctccaagtggtgtcgagcgtctt
atcgcccatgtcaaaaccttggccccggttcgcaccgcggtggtgcacccttgtgacgcg
ctcagcttgggcggtgccttggacgcgcgcgatgctggcgtcatcacgccagtattggtg
gcgccgctcgccaagctgcgtgccgttgcgaccgacacggggttggaactgggagacagc
gaggtcgtcgatgtgccgcacagccacgctgcagcggccatcgccgcccggctggctggc
aagggcgaggtgcaggcactgatgaaaggcagcttgcacagcgacgagtacctgggtgcc
atcctggcgcccgaagcctgcctgcgcaccgagcgccgattgacgcactgctacatcatg
cagacggccagctacccacggcccttcatcatcaccgacgccgccatcaacatcgctcca
acgctcgaaatcaaggccgacatcgtgcgcaacgccatcgacttggcgcacgccatcggc
attgccgagcccaaggtagcgatcctggcggcggtcgagaccgtcaacccgcgcatgctt
tcgaccctagacgcagcggcactgtgcaagatggccgatcgcggccagattaccggaggt
gtgctcgacgggccgctggcctttgataacgccgtctcttccgatgccgcgcgcgtcaag
ggcatcaagtccaccgtggccgggcaagccgatatcctggtcgttcccgacctggaaagc
ggaaacatgctggccaagcaactggaatatatgggccaagccgacagtgcggggatcgtg
atgggcgcgcgtgtgccgattgtgctcaccagtcgctcggactcgcgccgcacgcgaata
gcctcatgcgccattgcgctgatcttggcgcatagtcagcgtgctcttgtttag

DBGET integrated database retrieval system