KEGG   Acidovorax ebreus: Dtpsy_1313
Entry
Dtpsy_1313        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 PGAP1 DUF676 Hydrolase_4 Abhydrolase_2 UPF0227 Palm_thioest Thioesterase Abhydro_lipase DUF1475
Other DBs
NCBI-ProteinID: ACM32778
UniProt: B9MGV5
Position
1372008..1374026
AA seq 672 aa
MIHVILVFFWRWLIVIAAAFALGGCAVVSEFKPSVAVRAMTPDEYVALRRGDLLGKGKLS
ALTVQTIRVTGLDEWACAANASLTCIESLTMMKDLDGETRLSALAELWLQHAMSISTTVS
NSRTASTSAWIETARHAYAYLFFTGRSPGERAFEERQTQVRDWYNYAVQKTVTQLFGLQH
QALRAHAGGANAAFRLGNWVLRVDLNARLPNDATTPRELLPANALAFQGLRGIYRRDGLG
AELVAVTDAEPISLNDSDGSPAGNERPRTFPAWSEMPTPNVTVVLRFDALTVDELLASHE
LIVGVYDPLVQDYLQLHGQRVPLAGNFTAGYGLWLARSGFNQQSVRGLFGRERGIDHPHL
YLMQPFDPRRRIIVMMHGLASSPEAWVNVANELLADEKLRCEFQVWEVYYPTNMPVPASH
AAIRQVLAAALHHFDPDQETLASHGLVLIGHSMGGMLARLMVSTADQQLWKWAASDPRID
LDRLGSTRSQLDPLLRFQPFPGVDRVVFVATPHRGTVVAGQGLGRWVAGLIRLPLTLLST
LGDAFPARAETTAHATILQNIPNSIDQLDENDPFVKATSELSISDQVAYHSIVARRQANG
PLADSDDGLVPYRSAHLDGAESEKIIVSGHSVQETAESIVEIRRILREDISKHWLTAADS
SSVRGGSCPVQR
NT seq 2019 nt   +upstreamnt  +downstreamnt
gtgatccacgtgatccttgtatttttctggcgatggttgatcgtgatcgctgccgcgttt
gcgctcggtggttgcgcggttgtcagtgaattcaaaccttctgtcgctgtacgcgcgatg
acgccggatgaatacgtcgccctacgacgcggcgatctcctcggcaaaggcaaactcagt
gcactgaccgtgcagacgatccgtgttaccgggctcgatgaatgggcctgcgcagcgaac
gcatcgctcacttgtatcgagtcgttgaccatgatgaaggacttggacggagaaaccagg
ttgtcggcactggctgaactatggctgcagcatgccatgtcgatctcgacaacagtctca
aacagtcgcaccgcttctacttccgcttggatcgagacagctcggcacgcttacgcgtat
ctctttttcaccgggcgctcgcccggcgagcgcgcgtttgaggagcggcagacgcaggtg
cgcgattggtacaactatgcggtgcaaaaaacggtcacgcaattgtttggcctacagcac
caagcacttcgtgcgcatgctggcggagccaacgcggcattccgcttgggtaactgggtt
ttgcgagtcgacttgaacgcccggctgcccaatgatgcgaccacgccacgcgagttgctg
cctgcgaacgctctggcattccaaggcctgcgcggcatctatcgcagggatggcttgggt
gccgaattggtggccgtaacggatgcagagccaatatcactgaacgactcagacgggtct
cccgccggcaacgagcgcccgaggacatttcccgcctggagcgaaatgccaacgcccaac
gtgacggtagtgcttcgctttgatgcactcaccgtcgatgagctgcttgcctcgcatgaa
ctcatcgtcggtgtgtatgaccccctggtacaggactatttgcaactccacggccaacgc
gttccgctggctggtaacttcacggctggctacggcctgtggttggcgcgttcggggttc
aaccagcaatccgtgcgagggttgtttgggcgtgagcgtggcatcgatcacccgcatctg
tatctgatgcagccgttcgacccgcggcggcgcatcatcgtgatgatgcatggattggcg
agcagccccgaagcatgggtcaacgttgccaatgagcttctggccgatgaaaagctgcga
tgcgaattccaagtgtgggaggtctattaccccacgaatatgcctgtaccagccagtcat
gcagcaatccgccaagttctggcggccgctttgcatcacttcgaccctgatcaggaaacc
ttggcttcccacgggctggtgttgattggacacagcatgggaggaatgctggcgcggctg
atggtctccacggctgaccagcaactgtggaagtgggccgcatcggaccccaggatcgat
ctggatcgtcttgggagcacccgctctcaacttgaccctcttttgcgctttcagccattt
ccaggtgttgatcgcgtggtattcgttgccacaccgcaccgtggaaccgtggttgccgga
caaggacttgggcgttgggttgccggattgatccgcttgccattgacgctgctgtcaacc
ctcggcgacgccttcccggcgcgcgcggagaccacggcacacgccacgatcttgcagaac
atccccaacagcattgaccaactcgacgaaaacgaccccttcgtcaaagctacgagcgag
ctttcaatctcggatcaggtggcttatcactcgatcgttgcgaggcggcaggctaacggc
cctcttgctgactcggacgatggcttggttccctatcgaagcgcccatctggatggcgcc
gagtcggaaaaaatcatcgtgtccggacacagcgtgcaggaaaccgccgaatccatcgtc
gaaatccggcgaatcctgcgcgaagatatttccaagcattggttgacagccgctgattcg
tcttccgtccggggagggagctgcccagtccaacggtga

DBGET integrated database retrieval system