KEGG   Acidovorax ebreus: Dtpsy_1314
Entry
Dtpsy_1314        CDS       T00853                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_24
Other DBs
NCBI-ProteinID: ACM32779
UniProt: B9MH74
Position
1374218..1375144
AA seq 308 aa
MELRHLRCFTAVAEELHFARAAERLHIDQSPLSRTIKELEEDLGARLFVRTTRSTQLTRA
GRLLLEHVPRIFAALEQARDSVRSASNGYHGQLRIALSDGITPSRLPALLAQCREEDPEV
EVRLFEVSMAQQIKGLHDELYDAGFSMADYVGDGIVVTSAWEDELMVAVPARHPVLAFKQ
VPLEEVLHYPLVLGDPAICEGHARQVDRILRRHEQEPLIVQHVATFDLMMTLVSAGLALG
LAGAAHIGSSRELGVVARPLAGKPPMLTTYLLRRDAEVPEMLARFIERVAFIDSENYLST
AKNSRPTR
NT seq 927 nt   +upstreamnt  +downstreamnt
gtggagttacgccaccttcgatgttttaccgcggtcgcggaagagcttcattttgctcgg
gctgctgaacggttacacatcgaccaatcgccgctatctcgcaccatcaaggagctggag
gaagaccttggtgcgcgcctgttcgttcgtactacccgcagcacgcaattgacccgtgcg
ggtcgattgctgttggagcacgtaccgcgcatcttcgctgcgctggagcaagcacgcgat
agcgtcaggtctgcctccaatggctatcacgggcaattgcgcattgccttgtccgatggc
atcacgccatcacgtttaccggcgctacttgcgcagtgccgcgaagaagaccccgaagtc
gaggttcggttgttcgaggtttcgatggcccagcaaatcaagggcctgcacgatgagcta
tacgacgcaggattttcgatggccgactacgtgggcgatggcatcgtggtcacatctgcc
tgggaggacgaattgatggtggcagtacctgcccgccatcccgtgcttgccttcaagcag
gttccgctggaggaagtgctgcactatccgctggtgttgggcgatccggcgatatgcgaa
ggccatgcgcgccaggtcgatcgcatcctgcgcaggcacgagcaggagccgctgattgtt
cagcatgttgccacctttgacctcatgatgaccttggtttccgccggattggcattgggc
ctggctggtgcggcgcacatcggctccagccgcgagctcggtgtcgtggctcggcctttg
gcgggtaaaccaccgatgctgacgacctatctgctgcgtcgtgatgcggaggttccagaa
atgttggcacggttcatcgaacgagtggccttcattgactcggaaaattatctgagcacc
gccaaaaattcccgacccacccgatga

DBGET integrated database retrieval system