KEGG   Acidovorax ebreus: Dtpsy_1315
Entry
Dtpsy_1315        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: CfAFP LPAM_2
Other DBs
NCBI-ProteinID: ACM32780
UniProt: B9MH75
Position
1375158..1375385
AA seq 75 aa
MSKVMLLMLAATLTACGPSQPSETVDALAANPERIKEIQQLCKEDRAKVDDELCRRAAEA
AKRRFYGDRPEQKSR
NT seq 228 nt   +upstreamnt  +downstreamnt
atgagcaaggtgatgctgctgatgctggccgccacactgactgcatgtggcccttctcaa
ccttcggaaacggtggatgcactcgcagccaatcccgagcgcatcaaggagattcaacag
ctgtgcaaggaagaccgcgcgaaggtcgatgatgaactctgccgacgcgccgcagaagcc
gccaaacggcgtttctacggtgatcggccggagcagaaatctaggtag

DBGET integrated database retrieval system