KEGG   Acidovorax ebreus: Dtpsy_1316
Entry
Dtpsy_1316        CDS       T00853                                 

Definition
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_1316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_1316
Enzymes [BR:dia01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Dtpsy_1316
Secretion system [BR:dia02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Dtpsy_1316
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ACM32781
UniProt: B9MH76
Position
1375630..1377642
AA seq 670 aa
MQGTNVLFGQIAVVFGIVIAGVWSATQWTAAALGYQLRLGSPWFDLLGTPIYHPWKLFEW
WFFFDAYAPRVFDTGGAIAGGSGLVAVLVAIGMSIWRSRQSRLVTTYGTARWANAQDIRK
AGLTQPTGVFLGQHDRQYLRHEGPEHVLTFAPTRSGKGVGLVVPTLLSWPTSAVIHDIKG
ENWQITAGWRSRFSHCLLFNPTDATSAAYNPLLEVRRGANEVRDVQNIADILVDPEGALE
KRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPACPFELTLHRMMTTPHLGDGP
HPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLIAAEHPVS
LYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLG
TATELRAQRNYAGHRLAPWLGHLMVSRQETAPRAAAHAPGRGVHDRSGAFLDAPAPGSRR
GGRGARPRGAGSHQGLGHGSPRRYRHDPCRLRLGRAAAPGATDSRSGREPAACADRRGGQ
RGDPHCRARAQAPHREHRPRRRLRRRGLPIGGRFGGRDGHAVSRATARFRCRARCGDFPI
PSLNPSGELP
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgcaagggacgaacgtgctgttcggtcagatcgccgtggtattcggcatcgtgatcgcc
ggagtgtggagcgccacacaatggacagcagcagcccttggctatcagctacgccttggc
tcgccctggttcgatcttctcggcacaccgatctaccacccctggaagctgttcgagtgg
tggttcttcttcgatgcctacgcaccccgcgtctttgacacgggcggggccatcgcgggc
ggcagcggcctggtggccgtgctggtcgctatcggcatgtcaatctggcgctcgcggcag
tcgcgcctggtcacgacctacggtacggcacgctgggcgaatgcgcaggatattcgcaag
gccggcctcacgcagccgaccggcgtgttcctcggccagcatgatcgccaatacctgcgc
cacgaaggtccggaacacgtcctgaccttcgcgcccacgcgctcgggcaaaggcgtcggg
ctggtcgttcccacgctgctttcgtggcccacgtcggccgtcatccacgacatcaagggc
gagaactggcagatcaccgcaggttggcgctcgcgcttctcgcactgtctgttgttcaac
cccactgatgcaacgtcagcagcctacaacccgctactggaggtacgtcgcggcgcgaat
gaggtgcgcgacgtgcagaacatcgcggacattctggttgaccccgaaggtgcgctggag
aagcgcaaccattgggaaaagacttcgcatgcgctgctggtcggcgcgatcctgcatgtg
ctgtacgcgggcgaagacaagacgctacgaggtgtggcgaacttcctcagtgacccggcg
tgcccattcgagctgaccttgcaccggatgatgaccacgccgcacctgggcgatggcccg
catcccgtggttgcatcagcggcgcgcgaagtgctcaacaagagcgacaacgaacggtct
ggcgttctctccacggccatgtcgttccttggcctttaccgtgaccccacggtggccgaa
gtcacctcgcgctgcgactggcgcatcgccgacctgatcgctgccgagcatccggtatcg
ctgtacctcgtggtgccgccttcggacattagccgcaccaagccgctgatccgcctgatc
ctcaaccagatcggccgacggctgaccgaatcgctcgacgggtcggatggcatcgaacgc
cgccacaagctgctgctgatgctggatgagttcccggcgctggggcgcctggacttcttc
gagacggcgctggccttcatggcgggctacggcatccgcagctttctcatcgcgcaatca
ctcaaccagattgacaaagcctacggccaaaaccattccatcctcgacaactgccatgtc
cgagtgacgttcgcaaccaacgacgaacgcacggccaagcgtatttccgaaaccctggga
acggccaccgagctgcgcgcgcagcgcaactacgccggccatcggctcgcgccatggctc
gggcacctcatggtgtcgcggcaggaaacggcaccacgtgccgctgcgcacgcgccaggg
cgtggtgtccatgaccgatctggtgcgttcctcgatgcgcctgcgcccggatcgcgtcgt
ggtgggcgaggtgcgcggccccgaggcgctggatctcatcaaggtctggggcacgggtca
ccccggcggtatcgccacgatccatgccggctccgccttgggcgcgctgctgcgcctgga
gcaactgattctcgaagtggccgcgaacccgccgcgtgcgctgatcgccgaggcggtcaa
cgtggtgatccacattgccgggcgcgggcgcaagcgccgcatcgagagcatcgcccgcgt
cgtcggcttcgacggcgtgggctaccgattggtggacggtttggcggacgcgatggacac
gccgtttcccgagctaccgcccgtttccgatgccgcgcccgctgcggcgacttccccatc
ccgtccctcaatccctctggagaactgccatga

DBGET integrated database retrieval system