KEGG   Acidovorax ebreus: Dtpsy_1317
Entry
Dtpsy_1317        CDS       T00853                                 

Definition
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_1317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_1317
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_1317
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ACM32782
UniProt: B9MH77
Position
1377639..1378025
AA seq 128 aa
MTHVDAFRISVSPLFHLSRFTRLRSLAPPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPL
QSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFF
SFSGGAVV
NT seq 387 nt   +upstreamnt  +downstreamnt
atgacgcatgttgatgctttccgtatttccgtaagtccgcttttccacctgtcccgattc
acgcggctacgcagcctggctccccctgcggggcaagggctgctgctggccgcgctgctg
ctgttcctggccggcaccgcccaggccgccggttcctcgatgccgtgggaaggcccgctg
caatccatcctcgaatccatccagggaccggtggcgcgcatcgtcgcggtcatcatcatc
atcgccacgggcttggcgctggcctttggagatacgtcgggcggcttccgcaagctgatc
cagatcgtctttggcttgtccatcgctttcgcggcttcaagcttcttcctgtcgttcttc
agcttctcgggcggggccgtcgtatga

DBGET integrated database retrieval system