KEGG   Acidovorax ebreus: Dtpsy_1318
Entry
Dtpsy_1318        CDS       T00853                                 

Definition
(GenBank) putative conjugal transfer TrbD transmembrane protein
  KO
K20529  type IV secretion system protein TrbD
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_1318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_1318
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_1318
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ACM32783
UniProt: B9MH78
Position
1378022..1378294
AA seq 90 aa
MSAPDTFAAGFEVPLRRSLTEPILLGGAPRTVAIANGTLAATVGLGLQLWIPGVVLWIVG
HSLAVWGARVDPQFMQVFARHIKHKPLLDV
NT seq 273 nt   +upstreamnt  +downstreamnt
atgagtgccccggacactttcgcggccggtttcgaggtgccgctgcgtcgctcactgacc
gagccgattctgctgggcggggcgccgcgcacggtcgcaattgcgaacggcacgctcgcg
gccaccgtggggctgggcctgcaactgtggattcccggcgtggtgctctggatcgtcggc
cattcgctggcggtctggggtgcgcgcgtcgatccgcagttcatgcaggtctttgcgcgg
cacatcaagcacaagccgctgctggacgtgtga

DBGET integrated database retrieval system