KEGG   Acidovorax ebreus: Dtpsy_1319
Entry
Dtpsy_1319        CDS       T00853                                 

Definition
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_1319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_1319
Enzymes [BR:dia01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Dtpsy_1319
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_1319
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG DUF853 AAA_10 TraG-D_C AAA_22 CbiA AAA_16 ABC_tran Chloroa_b-bind FtsK_SpoIIIE DUF87
Other DBs
NCBI-ProteinID: ACM32784
UniProt: B9MH79
Position
1378305..1380764
AA seq 819 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRPAANYPHSEFPEPLSWLVDEERRATFEESGNHFESGYH
LTLAYLPPEESRARAEGMLYENRPTEGVDWRERLTAFVAETDRVFDLLDGVMPEIAWIDD
GQTLTYLHATISTRRYRVAVPEVPFHIDALLADSALVGGLAPMLGEQHLRVVSVRGFPTS
TWPGILGELNRLGFAYRWSTRFLCLDKAEAENELTRLRRQWFAKRKNVMALLRETIFQQE
SPLVDTDASNKAADADAALQELGGDQVAFGYLTATVTVLDADPAVADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNAHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAMLAMQFRRYSGSRIFAFDMGR
SMRATILGLGGEHYDLGADGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVAVGPDEKV
AIWSALGSLAGAPLEQRTVTGLSVLLQSNALRQALAPYVLGGAHGRLLDADHDQLGMADV
QCFEMEELMHSKAAVMAVLGYLFARFDERFDGAPTLLMLDEAWLFLDDLVFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPATLAFAGASTPQDQRDMDRVLLDAGVTGF
AGAWLRHRRLDWAADLLPSLPGLAPGSSRTADHPQENQP
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgctgaacctcgccgaatatcgacagcgtccggccctgctcgccgactggcttccgtgg
gccgggctggtcgcgccgggcgtcgtcttgaacaaggatggcagtttccagcgcacggcg
cgctttcgtgggcctgacctcgacagcgcgacgcagggcgagctgatcgccacgtcggcg
cgcttgaacaacgcgctgcgccggctcggctcgggctgggcgctcttcatcgaggccgag
cgccggcccgccgccaactatccgcactcggagttccccgagcctttgtcgtggctggtg
gacgaggaacgccgggccaccttcgaggaatcgggcaaccacttcgagagcggttatcac
ctgacactggcgtacctgccgcccgaggaatcacgcgcccgcgcggaggggatgctgtac
gagaaccgtcccaccgaaggcgtggactggcgcgagcgcctgacggccttcgtggcggaa
acggatcgcgtctttgacctgctcgatggcgtgatgccggagatagcctggatcgatgac
gggcagacgctgacctacctgcacgcgaccatctcgacgcggcgctatcgagtggcggtg
cccgaagtgccgtttcacatcgacgcgctgctggccgattccgcactggtcggtggcttg
gctcccatgctgggcgagcagcacctgcgcgtggtgtcggtgcggggttttccgacctcg
acctggccggggattctgggcgaactcaaccgcctgggctttgcctatcgctggagtacg
cgctttctctgcctggacaaagccgaggcggaaaacgaactcacccgcctgcgccgccaa
tggtttgccaagcgcaaaaacgtgatggcgctgctgcgcgagaccatcttccagcaggaa
tcgccgctggtcgataccgacgccagcaacaaggcggccgacgccgatgccgccttgcag
gagctgggcggcgatcaagtcgccttcggttacctcaccgccacggtgacggtgctcgat
gccgatccggccgtggccgacgagaagctgcgcatggtagagcgcgtcatccagggccgg
ggctttgtgacgattcccgaaaccctgaacgcggtcgatgcttggctgtcttcgatccct
ggcaacgcctacgccaatgtgcgccagcccatcgtctcgacgctgaacctggcgcacatg
atgccggtgtcggcggtgtgggccgggccggagaagaacgcgcacctcgatggcccgccg
ctgatcgtcacgcgcaccgacggcgcgacgccgttccggctggtcacgcacatcggcgac
gtgggccacacgctggtcgctggcccgacgggcatgggcaagtccgtcttgctcgccatg
ctggctatgcagttccggcgctactccggctcgcgcatctttgccttcgacatgggccgc
tccatgcgcgccaccatcctcgggctgggcggcgagcactacgacctgggtgccgatggc
gaaattgccttccagccgctcgcgcgcatcgaccgcgagggctaccgcacctgggccgct
gaatggatcgaaggcagactactacatgaaggcgtggcggtcggccccgatgagaaggtc
gcaatctggtcggcgctgggaagcctcgccggtgcgccgctggagcagcgcaccgtgacc
gggctttccgtgctgctgcaatcgaacgcgctgcgccaggccctcgcgccctatgtgctc
ggtggcgcccacggcaggcttctggacgccgaccatgaccagctgggcatggccgacgtg
cagtgcttcgagatggaggaactgatgcacagcaaggccgccgtcatggccgtgctgggc
tatctgttcgcgcgcttcgacgaacgcttcgacggtgcgcccacgctgctgatgctcgat
gaggcgtggctgtttctcgatgacctggtattcgcggcacgcatccggcagtggctcaag
acgctgcgcaagaagaacgtgtcggtgatcttcgctacgcagagccttgccgacatcaag
gattcgagcattgcgcccgcgatcatcgaaagctgcgccagccgcattttcctgcccaac
ccgcaggccaccgagccgcagattcgcacgatctacgagggcttcgggttgaactcgcgc
cagatcgagatcgtggcgaccgcgcagcccaagcgcgactactactaccagtcccgcctc
ggcaatcgcctgttcgacctcgacctggggccggccacgctggcctttgcgggcgcttcc
acgccgcaggaccagcgcgacatggatcgcgtgttgctggatgccggcgtgaccggcttc
gcgggcgcctggctgcgccatcgcaggctcgattgggcggccgacctgctgccctcactc
cccggacttgcgccgggttcctctcgtaccgctgaccacccacaggagaaccagccatga

DBGET integrated database retrieval system