KEGG   Acidovorax ebreus: Dtpsy_1323
Entry
Dtpsy_1323        CDS       T00853                                 
Name
(GenBank) Conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_1323
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_1323
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_1323
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: ACM32788
Position
1383247..1383951
AA seq 234 aa
MRFRKPQVRYADTPHPATPYQAAGQVWDDRIGSPRVQAKNWRLMALGCLTLALLMAGGLV
WRSAQSIVTPYVVEVDNAGQVRAVGEAATPYRPNDAQTAHHIARFVTLVRSLSIDPIVVR
QNWLDAYDYTTDKGAAVLNDYARVNDPFARIGKESVTVQITSVVRASDTSFNVRWTERRY
VNGAAAGLERWTAVVSIVLQPPRTEERLRKNPLGIYVNGLSWSRELDASEGAKP
NT seq 705 nt   +upstreamnt  +downstreamnt
atgcgattcagaaaaccgcaggtgcgctatgccgacacgccgcaccctgccacgccgtac
caagctgccggccaggtgtgggacgaccgtatcggctcaccgcgcgtgcaggcgaagaac
tggcgcctgatggccctcggctgcctgacgctcgcgctgttgatggccggtggcctggtg
tggcgctcggcgcagtccatcgtgacgccctacgtcgtggaagtggacaacgcgggacag
gtgcgcgccgtgggcgaagccgccacgccgtaccggcccaacgatgcacagacggcgcac
cacatcgcgcgcttcgtgacgctggtgcgctcgctgtccatcgaccccatcgtcgtccgc
cagaactggctcgacgcctacgactacacgaccgacaagggcgcggccgtgctcaacgac
tacgcgcgggtcaacgacccgttcgcgcgcatcggcaaggagtcggtgacggtgcagatc
accagtgtcgtgcgcgctagcgatacgtctttcaacgtgcgctggacggaacgccgctac
gtcaacggcgccgcggctggcctggagcggtggacggccgtggtgtccatcgtgctccag
ccgccgcgcaccgaagaacgcctgcgcaagaaccccttgggcatctacgtcaacgggctg
tcgtggagccgcgaactggatgcgtccgaaggagccaagccatga

DBGET integrated database retrieval system